DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Tricking the guard: exploiting plant defense for disease susceptibility. Tricking the guard: exploiting plant defense for disease susceptibility. Science (New York, N.Y.) 2012 imex curation Lorang J., Kidarsa T., Bradford CS., Gilbert B., Curtis M., Tzeng SC., Maier CS., Wolpert TJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lorang J., Kidarsa T., Bradford CS., Gilbert B., Curtis M., Tzeng SC., Maier CS., Wolpert TJ. DIP original experiment: DIP-268229X Science (New York, N.Y.) 2012 IMEx Tricking the guard: exploiting plant defense for disease susceptibility. Tricking the guard: exploiting plant defense for disease susceptibility. Tricking the guard: exploiting plant defense for disease susceptibility. Science (New York, N.Y.) 2012 imex curation Lorang J., Kidarsa T., Bradford CS., Gilbert B., Curtis M., Tzeng SC., Maier CS., Wolpert TJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lorang J., Kidarsa T., Bradford CS., Gilbert B., Curtis M., Tzeng SC., Maier CS., Wolpert TJ. DIP original experiment: DIP-268230X Science (New York, N.Y.) 2012 IMEx Tricking the guard: exploiting plant defense for disease susceptibility. Tricking the guard: exploiting plant defense for disease susceptibility. Tricking the guard: exploiting plant defense for disease susceptibility. Science (New York, N.Y.) 2012 imex curation Lorang J., Kidarsa T., Bradford CS., Gilbert B., Curtis M., Tzeng SC., Maier CS., Wolpert TJ. Only protein-protein interactions nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Lorang J., Kidarsa T., Bradford CS., Gilbert B., Curtis M., Tzeng SC., Maier CS., Wolpert TJ. DIP original experiment: DIP-268231X Science (New York, N.Y.) 2012 IMEx Tricking the guard: exploiting plant defense for disease susceptibility. lov1b_arath Disease susceptibility protein LOV1 LOV1 RPP8L1 Disease resistance protein RPP8-like protein 1 Protein LONG VEGETATIVE PHASE1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEGVVLFGVHKLWELLNRESARLNGIGEQVDGLKRQLGRLQSLLKDADAKKHESERVRNFLEDVRDIVYDAEDIIESFLLNEFRTKEKGIKKHARRLACFLVDRRKFASDIKGITKKISEVIGGMKSLGIQEIIDGASSMSLQERQREQKEIRQTFANSSESDLVGVEQSVEALAGHLVENDNIQVVSISGMGGIGKTTLARQVFHHDMVQRHFDGFAWVFVSQQFTQKHVWQRIWQELQPQNGDISHMDEHILQGKLFKLLETGRYLVVLDDVWKEEDWDRIKAVFPRKRGWKMLLTSRNEGVGIHADPKSFGFKTRILTPEESWKLCEKIVFHRRDETGTLSEVRVDEDMEAMGKEMVTCCGGLPLAVKVLGGLLATKHTVPEWKRVYDNIGPHLAGRSSLDDNLNSIYRVLSLSYEDLPMCLKHCFLYLAHFPEYYEIHVKRLFNYLAAEGIITSSDDGTTIQDKGEDYLEELARRNMITIDKNYMFLRKKHCQMHDMMREVCLSKAKEENFLEIFKVSTATSAINARSLSKSRRLSVHGGNALQSLGQTINKKVRSLLYFAFEDEFCILESTTPCFRSLPLLRVLDLSRVKFEGGKLPSSIGDLIHLRFLSLHRAWISHLPSSLRNLKLLLYLNLGFNGMVHVPNVLKEMQELRYLQLPMSMHDKTKLELSDLVNLESLMNFSTKYASVMDLLHMTKLRELSLFITDGSSDTLSSSLGQLRSLEVLHLYDRQEPRVAYHGGEIVLNCIHLKELELAIHMPRFPDQYLFHPHLSHIYLWCCSMEEDPIPILERLLHLKSVILTFGAFVGRRMVCSKGGFPQLCFLKLEELEELEEWIVEEGSMPLLRALTICNCRKLKLPGGINYITSLKELTIVGMKWKEKLVPGGEDYYKVQNIPNVQFINCDE DIP protein A7XGN8 original sequence version: 47 trxh5_arath Thioredoxin H5 TRX5 LIV1 Protein LOCUS OF INSENSITIVITY TO VICTORIN 1 Thioredoxin 5 F27F5.21 At1g45145 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGGLVASA DIP protein Q39241 original sequence version: 130 164FA8CDA98FC862 trxh3_arath Thioredoxin H3 TRX3 At5g42980 MBD2.18 Thioredoxin 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTVVAAA DIP protein Q42403 original sequence version: 138 7AFCE291C3EB8FE2 trx5-lov1-1 1 4 unspecified role unspecified role prey prey Region 22-60 Region 22-60 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association trx3-lov1-1 2 6 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role prey prey Region 22-60 Region 22-60 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association lov1-trx5-1 3 4 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana 5 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range nicbe Nicotiana benthamiana physical association physical association