DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Nature cell biology 2012 imex curation Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. DIP original experiment: DIP-268135X Nature cell biology 2012 IMEx Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Nature cell biology 2012 imex curation Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. DIP original experiment: DIP-268138X Nature cell biology 2012 IMEx Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Nature cell biology 2012 imex curation Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. DIP original experiment: DIP-268136X Nature cell biology 2012 IMEx Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. Nature cell biology 2012 imex curation Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tumbarello DA., Waxse BJ., Arden SD., Bright NA., Kendrick-Jones J., Buss F. DIP original experiment: DIP-268137X Nature cell biology 2012 IMEx Autophagy receptors link myosin VI to autophagosomes to mediate Tom1-dependent autophagosome maturation and fusion with the lysosome. myo6_human Unconventional myosin-VI MYO6 KIAA0389 Unconventional myosin-6 protein protein human Homo sapiens Human MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYDALVKSSEELLSALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK DIP protein Q9UM54 original sequence version: 150 DIP protein Q9UM54-3 original sequence version: 161 DIP protein Q9UM54 original sequence version: 161 3A8966E6864B8576 o60784-1 Target of Myb protein 1 TOM1 protein protein human Homo sapiens Human MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL DIP protein O60784-1 original sequence version: 148 tm1l2_human TOM1-like protein 2 TOM1L2 Target of Myb-like protein 2 protein protein human Homo sapiens Human MEFLLGNPFSTPVGQCLEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTVLETCVKNCGHRFHILVANRDFIDSVLVKIISPKNNPPTIVQDKVLALIQAWADAFRSSPDLTGVVHIYEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSPPMEAPAPASNPSGRKKPERSEDALFAL DIP protein Q6ZVM7 original sequence version: 102 6CB4B4433076D8D0 tom1_human Target of Myb protein 1 TOM1 protein protein human Homo sapiens Human MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNLIQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL DIP protein O60784 original sequence version: 148 DIP protein O60784 original sequence version: 146 C7D77B5669476242 myo6-tom1l2-1 4 7 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 5 unspecified role unspecified role bait bait Region 840-1294 Region 840-1294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UM54:p.Trp1202Leu W1202L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W L This feature has been corrected as a result of our quality control procedures. The original label was 'W1202L'. Wed May 02 16:40:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp1202leu' Tue Jun 30 19:03:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1202Leu' crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association myo6-tom1-1 1 7 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait human Homo sapiens Human association association myo6-tom1-2 2 6 unspecified role unspecified role prey prey Region 299-492 Region 299-492 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 5 unspecified role unspecified role bait bait Region 1036-1294 Region 1036-1294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association myo6-tom1-3 3 6 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 5 unspecified role unspecified role bait bait Region 840-1294 Region 840-1294 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9UM54:p.Trp1202Leu W1202L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W L This feature has been corrected as a result of our quality control procedures. The original label was 'W1202L'. Wed May 02 15:41:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp1202leu' Tue Jun 30 15:42:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp1202Leu' crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association