DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. Science (New York, N.Y.) 2012 imex curation Tischer T., Hörmanseder E., Mayer TU. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Tischer T., Hörmanseder E., Mayer TU. DIP original experiment: DIP-268228X Science (New York, N.Y.) 2012 IMEx The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. Science (New York, N.Y.) 2012 imex curation Tischer T., Hörmanseder E., Mayer TU. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tischer T., Hörmanseder E., Mayer TU. DIP original experiment: DIP-268222X Science (New York, N.Y.) 2012 IMEx The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. Science (New York, N.Y.) 2012 imex curation Tischer T., Hörmanseder E., Mayer TU. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tischer T., Hörmanseder E., Mayer TU. DIP original experiment: DIP-268223X Science (New York, N.Y.) 2012 IMEx The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. Science (New York, N.Y.) 2012 imex curation Tischer T., Hörmanseder E., Mayer TU. Only protein-protein interactions xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tischer T., Hörmanseder E., Mayer TU. DIP original experiment: DIP-268224X Science (New York, N.Y.) 2012 IMEx The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. Science (New York, N.Y.) 2012 imex curation Tischer T., Hörmanseder E., Mayer TU. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tischer T., Hörmanseder E., Mayer TU. DIP original experiment: DIP-268226X Science (New York, N.Y.) 2012 IMEx The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. Science (New York, N.Y.) 2012 imex curation Tischer T., Hörmanseder E., Mayer TU. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tischer T., Hörmanseder E., Mayer TU. DIP original experiment: DIP-268225X Science (New York, N.Y.) 2012 IMEx The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. Science (New York, N.Y.) 2012 imex curation Tischer T., Hörmanseder E., Mayer TU. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tischer T., Hörmanseder E., Mayer TU. DIP original experiment: DIP-268227X Science (New York, N.Y.) 2012 IMEx The APC/C inhibitor XErp1/Emi2 is essential for Xenopus early embryonic divisions. q5xh34_xenla Serine/threonine protein phosphatase 2A regulatory subunit ppp2r5e.S LOC495076 ppp2r5e XELAEV_18041141mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPTLEQPELFLKKLQQCGVIFDFMDTLSDLKMKEYKRSTLNELVDYVAISRGCLTEQTYPEAVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLIYEFFIRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPTLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQISKCVSSPHFQVAERALYYWNNEYIMSLIEENSNVVLPIMFASLYRISKEHWNPAIVALVYNVLKAFMEMNSTLFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRSDGIIPT DIP protein Q5XH34 original sequence version: 46 a9ywt2_xenla Serine/threonine protein phosphatase 2A regulatory subunit ppp2r5a.S ppp2r5a XELAEV_18028697mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSAISAAEKVDGFTRKSVRKAQRQRRSQGSSQFLGQGPPVELSPLPALKDATSNEQQDLFCQKLEQCCVLFDFMDSISDLKSKEIKRATLNELVEYVATNRGVLVETAYPEIIKMICSNIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFLLRFLESPDFQPSIAKRFVDQKFVQQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETDHFNGVAELLEILGSIINGFALPLKSEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFMEKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIQEPLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFGSLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDELTGSYKAERQREKKKELEREELWRRLDDLLLKKALADKQNPTLCVQNIQNNASAK DIP protein A9YWT2 original sequence version: 34 kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF DIP protein P17612 original sequence version: 171 DIP protein P17612 original sequence version: 175 DIP protein P17612 original sequence version: 178 DIP protein P17612-1 original sequence version: 177 DIP protein P17612 original sequence version: 186 DIP protein P17612 original sequence version: 102 DIP protein P17612-1 original sequence version: 102 BF6D3ECD2614E5AB q6gq04_xenla cdc27.S MGC80529 cdc27 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKAHSCTTPQCKYLLAKCCVDLGKLAEGEQILSGGVLNKQKSQEEIVTEFGDSACFTLSLLGHVYCKTDRLAKGAECYQKSLSLNPFLWSPFESLCEIGEKPDAEQTFKLTSLQSFSNCVPNTCTMTVNTHSVVQHRQPDTVLMETPQDTIELNRLNLESSNIKYPLNSDSSISYIDPGVISPDSLPLGTGNAILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQSYNSSCVLDVPSSGAPTKKSVARISQAGTKSVFSQSGNSRDVTPVLLVQTQGSGPQTSTTPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKMPNRKTKSKTSKGGGTQTNLNDSLEISKLDSSIISEGKISSVAPQIQALTIQKAAAEGLMSLLRDMGKGYVALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYLQAERVFSEVRRIESYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPGYAYAFTLLGHEFVLTEELDKALACFRNSIRVNSRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSDKALDTLNKAISIDPKNPLCKFHRASILFANEKYKLALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEAVTQEEQISECYPYESVATDESQESSMTDADDTQLHAAESDEF DIP protein Q6GQ04 original sequence version: 70 F3E4E06D8CB53604 q6dfl3_xenla Serine/threonine protein phosphatase 2A regulatory subunit ppp2r5b.L ppp2r5b ppp2r5e-prov XELAEV_18026204mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSAISAAEKVDGFTRKSVRKAQRQRRSQGSSQFRGQGPPVELSPLPPLKDATSNEQQDLFCQKLQQCCVLFDFIDSISDLKSKEIKRATLNELVEYVATNRGILVEPAYPDIIKMICSNIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAKRFVDQKFVQQLLDLFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETDHFNGVAELLEILGSIINGFALPLKSEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFLEKDTALTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIQEPLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKVLPIMFGSLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDELTSSYKAERQREKKKEVEREELWRRLDELLLKKSLSDKQNPALCVQNIQNNASAK DIP protein Q6DFL3 original sequence version: 50 fbx43_xenla F-box only protein 43 fbxo43 emi2 erp1 fbx26 Early mitotic inhibitor 2 Emi1-related protein 1 F-box protein 26 Xerp1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MANLLENFAAHHSMTAGAKKKADHQDTSVSQDSGYSDSLKGFSPDSHKSGNFLETVTEGYENSENIDPTLILSPIKYELSWGADTRESKQLAPLYETPRVGKKEFSLRRRLLISKATSGGNLDFDVSVCSAESCGREKSLRRIPSHEGSLSNSFADSPRDGSYEPIATSTLKTESESGTSCKKWRLSFAQQRSSTLDDSKSDSIPLPEVENISPVQHSLASSTDDSILYEETIFGAPTTPTCNFIVKEEFQTPISNLAANFRFNLCTPDVGHVSDFDISVTEDSAFHSLSLDKSQDSITDHEGSFQELIQKPRETSKAVNNKSRLRKLDRCRRLSTLRERGSQSEVEEEGNEVPVLSSAYKLKVARASVDEENEFSSDESRVHSLLSSDDLTGKPALRVLHEMLLRSTRKRPQQATVQDLLGSSGCFELPEDSLSRLIGRKMGLETFDILAELKNRNLKHILASILDLVNAASICSMCRVSRDWRDVVLQDKSAHQRRKAYIKKLKTEAEQGRQLSFEDSATRLNILSRSALRSVQIQARSAFRTPTSSLTPGDNKSIHSASKHQEYLKVAKTLFTDEALKPCPRCQYPAKYQALKKRGTCSRKDCGFDFCSLCLCTFHGSKECGTGSAKRIPKKEALPGSAQSKRNLKRL DIP protein Q8AXF4 original sequence version: 51 DIP protein Q8AXF4 original sequence version: 26 DIP protein Q8AXF4 original sequence version: 47 DIP protein Q8AXF4 original sequence version: 56 mint 48C53C789FE6491D fbxo43-prkaca-1 1 10 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 13 enzyme target enzyme target substrate substrate unspecified role unspecified role Q8AXF4:p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala] S335A/T336A/S342A/S344A mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S335A/T336A/S342A/S344A'. Wed May 02 18:36:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser335ala,thr336ala,ser342ala,ser344ala' Tue Jun 30 17:54:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala]' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation fbxo43-cdc27-1 2 13 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog 11 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association fbxo43-ppp2r5e-1 6 13 unspecified role unspecified role bait bait Region 301-400 Region 301-400 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8AXF4:p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala] S335A/T336A/S342A/S344A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S335A/T336A/S342A/S344A'. Wed May 02 20:15:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser335ala,thr336ala,ser342ala,ser344ala' Tue Jun 30 18:50:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association cdc27-fbxo43-1 3 13 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog 11 unspecified role unspecified role bait bait xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association fbxo43-ppp2r5b-1 7 13 unspecified role unspecified role bait bait Region 301-400 Region 301-400 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8AXF4:p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala] S335A/T336A/S342A/S344A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S335A/T336A/S342A/S344A'. Wed May 02 16:56:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser335ala,thr336ala,ser342ala,ser344ala' Tue Jun 30 17:34:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association ppp2r5e-fbxo43-1 4 13 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog 8 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association fbxo43-ppp2r5a-1 5 13 unspecified role unspecified role bait bait Region 301-400 Region 301-400 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8AXF4:p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala] S335A/T336A/S342A/S344A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S335A/T336A/S342A/S344A'. Wed May 02 19:19:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser335ala,thr336ala,ser342ala,ser344ala' Tue Jun 30 20:09:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser335Ala;Thr336Ala;Ser342Ala;Ser344Ala]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association