DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. Nature structural & molecular biology 2012 imex curation Kitamura S., Ode H., Nakashima M., Imahashi M., Naganawa Y., Kurosawa T., Yokomaku Y., Yamane T., Watanabe N., Suzuki A., Sugiura W., Iwatani Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kitamura S., Ode H., Nakashima M., Imahashi M., Naganawa Y., Kurosawa T., Yokomaku Y., Yamane T., Watanabe N., Suzuki A., Sugiura W., Iwatani Y. DIP original experiment: DIP-251161X Nature structural & molecular biology 2012 IMEx The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. Nature structural & molecular biology 2012 imex curation Kitamura S., Ode H., Nakashima M., Imahashi M., Naganawa Y., Kurosawa T., Yokomaku Y., Yamane T., Watanabe N., Suzuki A., Sugiura W., Iwatani Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kitamura S., Ode H., Nakashima M., Imahashi M., Naganawa Y., Kurosawa T., Yokomaku Y., Yamane T., Watanabe N., Suzuki A., Sugiura W., Iwatani Y. DIP original experiment: DIP-251160X Nature structural & molecular biology 2012 IMEx The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. Nature structural & molecular biology 2012 imex curation Kitamura S., Ode H., Nakashima M., Imahashi M., Naganawa Y., Kurosawa T., Yokomaku Y., Yamane T., Watanabe N., Suzuki A., Sugiura W., Iwatani Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kitamura S., Ode H., Nakashima M., Imahashi M., Naganawa Y., Kurosawa T., Yokomaku Y., Yamane T., Watanabe N., Suzuki A., Sugiura W., Iwatani Y. DIP original experiment: DIP-251162X Nature structural & molecular biology 2012 IMEx The APOBEC3C crystal structure and the interface for HIV-1 Vif binding. abc3c_human DNA dC->dU-editing enzyme APOBEC-3C APOBEC1-like Phorbolin I APOBEC3C APOBEC1L PBI protein protein human Homo sapiens Human MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ DIP protein Q9NRW3 original sequence version: 71 DIP protein Q9NRW3 original sequence version: 93 BE49E80F95C71214 abc3f_human DNA dC->dU-editing enzyme APOBEC-3F APOBEC3F Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F protein protein human Homo sapiens Human MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE DIP protein Q8IUX4 original sequence version: 118 DIP protein Q8IUX4-1 original sequence version: 97 DIP protein Q8IUX4-1 original sequence version: 89 AF1A0E13830695F4 b2cml4_human APOBEC3DE hCG_41704 protein protein human Homo sapiens Human MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ DIP protein B2CML4 original sequence version: 35 q77yg0_9hiv1 Virion infectivity factor vif SOR protein protein protein 9hiv1 Human immunodeficiency virus 1 MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPELADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLALAALITPKKIKPPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH DIP protein Q77YG0 original sequence version: 49 DIP protein Q77YG0 original sequence version: 39 apobec3c-vif-1 2 7 unspecified role unspecified role prey prey Q77YG0:p.[Ser144Ala;Leu145Ala;Gln146Ala] S144A/L145A/Q146A mutation mutation certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S144A/L145A/Q146A'. Wed May 02 17:13:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser144ala,leu145ala,gln146ala' Tue Jun 30 18:45:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser144Ala;Leu145Ala;Gln146Ala]' human Homo sapiens Human 4 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9NRW3:p.Phe75Trp F75W mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F W This feature has been corrected as a result of our quality control procedures. The original label was 'F75W'. Wed May 02 16:03:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe75trp' Tue Jun 30 16:44:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe75Trp' Q9NRW3:p.Cys76Lys C76K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C K This feature has been corrected as a result of our quality control procedures. The original label was 'C76K'. Wed May 02 17:26:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys76lys' Tue Jun 30 20:10:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys76Lys' Q9NRW3:p.Ile79Ala I79A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I79A'. Wed May 02 17:53:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile79ala' Tue Jun 30 16:50:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile79Ala' Q9NRW3:p.Leu80Ala L80A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L80A'. Wed May 02 16:19:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu80ala' Tue Jun 30 19:59:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu80Ala' Q9NRW3:p.[Ile79Ala;Leu80Ala] I79A/L80A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I79A/L80A'. Wed May 02 18:13:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile79ala,leu80ala' Tue Jun 30 18:44:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile79Ala;Leu80Ala]' Q9NRW3:p.Ser81Pro S81P mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S P This feature has been corrected as a result of our quality control procedures. The original label was 'S81P'. Wed May 02 15:11:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser81pro' Tue Jun 30 18:06:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser81Pro' Q9NRW3:p.Tyr86Ala Y86A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y86A'. Wed May 02 14:48:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr86ala' Tue Jun 30 18:35:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr86Ala' Q9NRW3:p.Glu106Lys E106K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E106K'. Wed May 02 18:13:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu106lys' Tue Jun 30 16:45:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu106Lys' Q9NRW3:p.His111Asp H111D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H D This feature has been corrected as a result of our quality control procedures. The original label was 'H111D'. Wed May 02 18:14:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his111asp' Tue Jun 30 16:24:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His111Asp' Q9NRW3:p.Glu141Lys E141K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E141K'. Wed May 02 18:22:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu141lys' Tue Jun 30 18:35:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu141Lys' Q9NRW3:p.Glu141Ala E141A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E141A'. Wed May 02 18:00:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu141ala' Tue Jun 30 19:49:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu141Ala' human Homo sapiens Human physical association physical association apobec3f-vif-2 1 5 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q8IUX4:p.[Ile262Ala;Leu263Ala] I262A/L263A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I262A/L263A'. Wed May 02 15:17:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile262ala,leu263ala' Tue Jun 30 16:58:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile262Ala;Leu263Ala]' Q8IUX4:p.Leu255Asp L255D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L255D'. Wed May 02 17:15:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu255asp' Tue Jun 30 18:36:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu255Asp' Q8IUX4:p.Phe258Ala F258A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F258A'. Wed May 02 14:37:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe258ala' Tue Jun 30 19:27:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe258Ala' Q8IUX4:p.Cys259Lys C259K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C K This feature has been corrected as a result of our quality control procedures. The original label was 'C259K'. Wed May 02 16:55:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys259lys' Tue Jun 30 17:44:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys259Lys' Q8IUX4:p.Ser264Asp S264D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S264D'. Wed May 02 16:51:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser264asp' Tue Jun 30 18:23:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser264Asp' Q8IUX4:p.Tyr269Ala Y269A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y269A'. Wed May 02 18:39:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr269ala' Tue Jun 30 19:29:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr269Ala' Q8IUX4:p.Glu289Lys E289K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E289K'. Wed May 02 17:22:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu289lys' Tue Jun 30 19:15:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu289Lys' Q8IUX4:p.Phe290Lys F290K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F K This feature has been corrected as a result of our quality control procedures. The original label was 'F290K'. Wed May 02 15:27:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe290lys' Tue Jun 30 17:40:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe290Lys' Q8IUX4:p.His294Asp H294D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H D Wed May 02 19:29:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his294asp' Tue Jun 30 20:17:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His294Asp' Q8IUX4:p.Glu324Lys E324K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E324K'. Wed May 02 19:10:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu324lys' Tue Jun 30 17:07:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu324Lys' Q8IUX4:p.Glu324Ala E324A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E324A'. Wed May 02 16:46:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu324ala' Tue Jun 30 20:24:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu324Ala' human Homo sapiens Human 7 unspecified role unspecified role prey prey Q77YG0:p.[Ser144Ala;Leu145Ala;Gln146Ala] S144A/L145A/Q146A mutation mutation certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S144A/L145A/Q146A'. Wed May 02 15:02:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser144ala,leu145ala,gln146ala' Tue Jun 30 20:20:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser144Ala;Leu145Ala;Gln146Ala]' human Homo sapiens Human physical association physical association apobec3de-vif-1 3 6 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range B2CML4:p.Leu268Asp L268D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L D This feature has been corrected as a result of our quality control procedures. The original label was 'L268D'. Wed May 02 18:39:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu268asp' Tue Jun 30 16:26:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu268Asp' B2CML4:p.Phe271Lys F271K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F K This feature has been corrected as a result of our quality control procedures. The original label was 'F271K'. Wed May 02 17:30:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe271lys' Tue Jun 30 17:07:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe271Lys' B2CML4:p.Cys272Lys C272K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain C K This feature has been corrected as a result of our quality control procedures. The original label was 'C272K'. Wed May 02 15:20:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys272lys' Tue Jun 30 15:40:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys272Lys' B2CML4:p.[Ile275Ala;Leu276Ala] I275A/L276A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I275A/L276A'. Wed May 02 17:34:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile275ala,leu276ala' Tue Jun 30 17:54:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile275Ala;Leu276Ala]' B2CML4:p.Ser277Asp S277D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S277D'. Wed May 02 19:02:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser277asp' Tue Jun 30 17:32:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser277Asp' B2CML4:p.Tyr282Ala Y282A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y282A'. Wed May 02 19:01:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr282ala' Tue Jun 30 17:25:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr282Ala' B2CML4:p.Glu302Lys E302K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E302K'. Wed May 02 18:45:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu302lys' Tue Jun 30 16:22:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu302Lys' B2CML4:p.Phe303Lys F303K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F K This feature has been corrected as a result of our quality control procedures. The original label was 'F303K'. Wed May 02 14:54:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe303lys' Tue Jun 30 15:37:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe303Lys' B2CML4:p.His307Asp H307D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain H D This feature has been corrected as a result of our quality control procedures. The original label was 'H307D'. Wed May 02 18:57:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his307asp' Tue Jun 30 16:08:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His307Asp' B2CML4:p.Glu337Lys E337K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E K This feature has been corrected as a result of our quality control procedures. The original label was 'E337K'. Wed May 02 20:30:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu337lys' Tue Jun 30 17:45:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu337Lys' B2CML4:p.Glu337Ala E337A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E337A'. Wed May 02 16:45:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu337ala' Tue Jun 30 20:24:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu337Ala' human Homo sapiens Human 7 unspecified role unspecified role prey prey Q77YG0:p.[Ser144Ala;Leu145Ala;Gln146Ala] S144A/L145A/Q146A mutation mutation certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S144A/L145A/Q146A'. Wed May 02 14:59:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser144ala,leu145ala,gln146ala' Tue Jun 30 15:47:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser144Ala;Leu145Ala;Gln146Ala]' human Homo sapiens Human physical association physical association