DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Structure (London, England : 1993) 2012 imex curation Oot RA., Huang LS., Berry EA., Wilkens S. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Oot RA., Huang LS., Berry EA., Wilkens S. DIP original experiment: DIP-251177X Structure (London, England : 1993) 2012 IMEx Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Structure (London, England : 1993) 2012 imex curation Oot RA., Huang LS., Berry EA., Wilkens S. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Oot RA., Huang LS., Berry EA., Wilkens S. DIP original experiment: DIP-251179X Structure (London, England : 1993) 2012 IMEx Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Structure (London, England : 1993) 2012 imex curation Oot RA., Huang LS., Berry EA., Wilkens S. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Oot RA., Huang LS., Berry EA., Wilkens S. DIP original experiment: DIP-251178X Structure (London, England : 1993) 2012 IMEx Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. Structure (London, England : 1993) 2012 imex curation Oot RA., Huang LS., Berry EA., Wilkens S. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Oot RA., Huang LS., Berry EA., Wilkens S. DIP original experiment: DIP-251180X Structure (London, England : 1993) 2012 IMEx Crystal structure of the yeast vacuolar ATPase heterotrimeric EGC(head) peripheral stalk complex. vatg_yeast V-type proton ATPase subunit G VMA10 YHR039C-A YHR039BC YHR039C-B Vacuolar proton pump subunit G V-ATPase 13 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQKNGIATLLQAEKEAHEIVSKARKYRQDKLKQAKTDAAKEIDSYKIQKDKELKEFEQKNAGGVGELEKKAEAGVQGELAEIKKIAEKKKDDVVKILIETVIKPSAEVHINAL 259660D440A933D0 259660D440A933D0 vate_yeast V-type proton ATPase subunit E VMA4 VAT5 O6241 YOR332W Vacuolar proton pump subunit E V-ATPase 27 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDGNFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPILQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLNKDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD 7AC5169FF7E5A39C 7AC5169FF7E5A39C vatc_yeast V-type proton ATPase subunit C VMA5 VAT3 VATC YKL410 YKL080W Vacuolar proton pump subunit C V-ATPase 42 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MATALYTANDFILISLPQNAQPVTAPGSKTDSWFNETLIGGRAFVSDFKIPEFKIGSLDTLIVESEELSKVDNQIGASIGKIIEILQGLNETSTNAYRTLPINNMPVPEYLENFQWQTRKFKLDKSIKDLITLISNESSQLDADVRATYANYNSAKTNLAAAERKKTGDLSVRSLHDIVKPEDFVLNSEHLTTVLVAVPKSLKSDFEKSYETLSKNVVPASASVIAEDAEYVLFNVHLFKKNVQEFTTAAREKKFIPREFNYSEELIDQLKKEHDSAASLEQSLRVQLVRLAKTAYVDVFINWFHIKALRVYVESVLRYGLPPHFNIKIIAVPPKNLSKCKSELIDAFGFLGGNAFMKDKKGKINKQDTSLHQYASLVDTEYEPFVMYIINL 0CD1B814046C377E 0CD1B814046C377E v_atpase_c-v_atpase_e-3 1 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Head domain Region 158-277 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association v_atpase_e-v_atpase_g-3 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction v_atpase_g-v_atpase_e-1 4 5 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association v_atpase_c-v_atpase_e-4 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Head domain Region 158-277 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction