DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Identification of unknown protein function using metabolite cocktail screening. Identification of unknown protein function using metabolite cocktail screening. Structure (London, England : 1993) 2012 imex curation Shumilin IA., Cymborowski M., Chertihin O., Jha KN., Herr JC., Lesley SA., Joachimiak A., Minor W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shumilin IA., Cymborowski M., Chertihin O., Jha KN., Herr JC., Lesley SA., Joachimiak A., Minor W. DIP original experiment: DIP-251012X Structure (London, England : 1993) 2012 IMEx Identification of unknown protein function using metabolite cocktail screening. Identification of unknown protein function using metabolite cocktail screening. Identification of unknown protein function using metabolite cocktail screening. Structure (London, England : 1993) 2012 imex curation Shumilin IA., Cymborowski M., Chertihin O., Jha KN., Herr JC., Lesley SA., Joachimiak A., Minor W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shumilin IA., Cymborowski M., Chertihin O., Jha KN., Herr JC., Lesley SA., Joachimiak A., Minor W. DIP original experiment: DIP-251011X Structure (London, England : 1993) 2012 IMEx Identification of unknown protein function using metabolite cocktail screening. Identification of unknown protein function using metabolite cocktail screening. Identification of unknown protein function using metabolite cocktail screening. Structure (London, England : 1993) 2012 imex curation Shumilin IA., Cymborowski M., Chertihin O., Jha KN., Herr JC., Lesley SA., Joachimiak A., Minor W. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shumilin IA., Cymborowski M., Chertihin O., Jha KN., Herr JC., Lesley SA., Joachimiak A., Minor W. DIP original experiment: DIP-251013X Structure (London, England : 1993) 2012 IMEx Identification of unknown protein function using metabolite cocktail screening. nnrd_bacsu ADP-dependent (S)-NAD(P)H-hydrate dehydratase nnrD yxkO BSU38720 ADP-dependent NAD(P)HX dehydratase protein protein bacsu Bacillus subtilis MNVPFWTEEHVRATLPERDAESHKGTYGTALLLAGSDDMPGAALLAGLGAMRSGLGKLVIGTSENVIPLIVPVLPEATYWRDGWKKAADAQLEETYRAIAIGPGLPQTESVQQAVDHVLTADCPVILDAGALAKRTYPKREGPVILTPHPGEFFRMTGVPVNELQKKRAEYAKEWAAQLQTVIVLKGNQTVIAFPDGDCWLNPTGNGALAKGGTGDTLTGMILGMLCCHEDPKHAVLNAVYLHGACAELWTDEHSAHTLLAHELSDILPRVWKRFE DIP protein P94368 original sequence version: 92 nnre_mouse NAD(P)H-hydrate epimerase Naxe Aibp Apoa1bp Apolipoprotein A-I-binding protein NAD(P)HX epimerase protein protein mouse Mus musculus Mouse MSGLRTLLGLGLLVAGSRLPRVISQQSVCRARPIWWGTQRRGSETMAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ DIP protein Q8K4Z3 original sequence version: 78 mint DFD95155755D8D96 nnr_thema Bifunctional NAD(P)H-hydrate repair enzyme Nnr nnr Nicotinamide nucleotide repair protein TM_0922 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLKE DIP protein Q9X024 original sequence version: 60 nnr-1 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction naxe-1 1 5 unspecified role unspecified role unspecified role unspecified role Region 25-282 Region 25-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nnrd-1 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction