DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. DIP original experiment: DIP-253591X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. DIP original experiment: DIP-253590X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. DIP original experiment: DIP-253588X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. DIP original experiment: DIP-253589X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. DIP original experiment: DIP-253586X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yu F., Qian L., Nibau C., Duan Q., Kita D., Levasseur K., Li X., Lu C., Li H., Hou C., Li L., Buchanan BB., Chen L., Cheung AY., Li D., Luan S. DIP original experiment: DIP-253587X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx FERONIA receptor kinase pathway suppresses abscisic acid signaling in Arabidopsis by activating ABI2 phosphatase. rogf4_arath Rop guanine nucleotide exchange factor 4 ROPGEF4 Rho of plants guanine nucleotide exchange factor 4 F4I18.13 At2g45890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSSNSDQNEGTPTSSVSSPYRRTYSDISGLSHRFDVQSFYNRPSNTNAVVLSGHEEDVSEDAEEPKDDVVNDVHGDGDEEDSDIDSAEDAELEMMRERFAKLLLGEDMSGSGKGVCTAVTVSNSITNLYATVFGQSLRLQPLSTEKKDLWKREMNCFMSICDYIVEVIPRSLGTNVEITETKLRSDILMSLPALRKLDNMLMEILDSFTENEFWYVERGSSSMNSGGGGRDSGTFRKVVVQRKDEKWWLPVPCVPAEGLSEEERKHLRHKRDCASQIHKAALAINDSTLNDMDIPDSYLTTLPKSGKASVGDVIYKQLCTAEKFYPDQLLDILKITSEHEALELADKVEASLVTWRRKTGGLTHSKSSWDMMKDISGDADRGNDKNHILAARARSLLFCLKQRYPELSQTSLDICKIQFNRDVGKAVLESYSRVLEGLAYNVVSWIDDVLYVDRTVRNRDD DIP protein Q0WNP7 original sequence version: 33 DIP protein Q0WNP7 original sequence version: 50 mint 41C2DA9959AA74C1 o04719-1 Protein phosphatase 2C 77 PP2C77 ABI2 Protein ABSCISIC ACID-INSENSITIVE 2 Protein phosphatase 2C ABI2 MHM17.19 At5g57050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEVSPAVAVPFRPFTDPHAGLRGYCNGESRVTLPESSCSGDGAMKDSSFEINTRQDSLTSSSSAMAGVDISAGDEINGSDEFDPRSMNQSEKKVLSRTESRSLFEFKCVPLYGVTSICGRRPEMEDSVSTIPRFLQVSSSSLLDGRVTNGFNPHLSAHFFGVYDGHGGSQVANYCRERMHLALTEEIVKEKPEFCDGDTWQEKWKKALFNSFMRVDSEIETVAHAPETVGSTSVVAVVFPTHIFVANCGDSRAVLCRGKTPLALSVDHKPDRDDEAARIEAAGGKVIRWNGARVFGVLAMSRSIGDRYLKPSVIPDPEVTSVRRVKEDDCLILASDGLWDVMTNEEVCDLARKRILLWHKKNAMAGEALLPAEKRGEGKDPAAMSAAEYLSKMALQKGSKDNISVVVVDLKGIRKFKSKSLN DIP protein O04719-1 original sequence version: 129 DIP protein O04719 original sequence version: 91 DIP protein O04719 original sequence version: 89 DIP protein O04719 original sequence version: 93 DIP protein O04719-1 original sequence version: 94 DIP protein O04719 original sequence version: 141 DIP protein O04719 original sequence version: 117 rogfa_arath Rop guanine nucleotide exchange factor 10 ROPGEF10 Rho of plants guanine nucleotide exchange factor 10 At5g19560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFDGRNSGHSSFSSRGDGMHTPEHELAGHAAPSTRRGKQNRRSDMEVMKERFAKLLLGEDMSGGGTGETSALALSNAITKLADSMFGEQMKLQPMYPETKENWRKEMGWLLSVIDHIVQFVPSRQMGKNGQFTEIMVTKQRDDLLTNIPALRKLDSVLLETLDNFKDQKDFWYVPRDMEDADHNGDWRRDENWWLPVVKVPTDGLSEESRRWLQNQKDSVAQVLKAATAINAHVLSEMHVPENYIDSLPKNGKTSLGDFLYKSITEESFDPDYFVSFLDLSTEHKVLDLKNRIEASMVIWKRKMCQKEKDGKSQWGSTVSLEKRELFEVRAETILVMLKQQFPGIPQSSLEVSKIKNNKDVGQAILESYSRVLESLASKIMSRIEDVLEADRLVQRQLMGEAETRSESEAESEYEETEKVVAAETPNSRKLSDFIGWRLSSDTKKHSSMSDIEFFHKVEQEKEKPMMKSPRALPKKFSYLAKLENMRSPSDRH DIP protein Q1KS66 original sequence version: 1 DIP protein Q1KS66 original sequence version: 18 srk2e_arath Serine/threonine-protein kinase SRK2E SNRK2.6 Serine/threonine-protein kinase OST1 Protein OPEN STOMATA 1 SNF1-related kinase 2.6 F17I5.140 SRK2E OST1 At4g33950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDRPAVSGPMDLPIMHDSDRYELVKDIGSGNFGVARLMRDKQSNELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYCHAMQVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATVPPAGTQNLNHYLTGSLDIDDDMEEDLESDLDDLDIDSSGEIVYAM DIP protein Q940H6 original sequence version: 63 DIP protein Q940H6-1 original sequence version: 62 DIP protein Q940H6-1 original sequence version: 66 DIP protein Q940H6 original sequence version: 76 DIP protein Q940H6-1 original sequence version: 67 DIP protein Q940H6 original sequence version: 89 DIP protein Q940H6 original sequence version: 91 FFBCCA1474839B88 rogf1_arath Rop guanine nucleotide exchange factor 1 ROPGEF1 Rho of plants guanine nucleotide exchange factor 1 Kinase partner protein-like F22I13.200 At4g38430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLSSEEDDEVSSERCGSYSPSADISESESSSSFSCHRFDGEGASSSIPSSPRVVAGRGFYFPAPVMLPVIGGKDVVWDDKQPDNDLSEIEMMKERFAKLLLGEDMSGGGKGVCTALAISNAITNLSATVFGELWRLEPLAPQKKAMWRRELEWLLCVSDSIVELIPSIQQFPGGGTYEIMETRPRSDLYANLPALKKLDAMLIDMLDAFSDTEFWYTDRGIVLGDCDKDSYNSPASVRQEDKWWLPCPKVPPNGLSEEARKKLQQCRDFANQILKAALAINSGVLAEMEIPDPYLETLPKSGKECLGEIIYQYLTANKFSPECLLDCLDLSSEHQTLEIANRIEAAVHVWRQKNGRRHKKQAKLKLSSWGGKVKGLVNDNERNDFLVQRAETLLQSLRIRFPGLPQTTLDMNKIQYNKDVGQSILESYSRVMESMAFNITARIDDVLYVDDAMRRSISVTESLSLFSINGLNPQKAFSVQSSPHGSPFATPALSVASRSPRRAPPLYSVKRNGTREKGIVGETEKAWSYAGNLSSRRVTGVTPERD DIP protein Q93ZY2 original sequence version: 48 DIP protein Q93ZY2 original sequence version: 80 DIP protein Q93ZY2 original sequence version: 60 7E6A8086E0FA5EC6 rac10_arath Rac-like GTP-binding protein ARAC10 ARAC10 ROP11 MQB2.20 MQB2.180 At5g62880 GTPase protein ROP11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKPLVKQKEKTKKKKKQKSNHGCLSNVLCGRIVTRH DIP protein O82481 original sequence version: 90 02575631F7582E3B arac10-abi2-1 5 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait O82481:p.Asp123Ala D123A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D123A'. Wed May 02 17:22:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp123ala' Tue Jun 30 18:09:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp123Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association arac10-ropgef10-1 4 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait O82481:p.Asp123Ala D123A mutation mutation certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D123A'. Wed May 02 19:49:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp123ala' Tue Jun 30 18:12:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp123Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association srk2e-4 1 10 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true arac10-ropgef1-3 6 11 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait O82481:p.Asp123Ala D123A mutation mutation certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D123A'. Wed May 02 19:13:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp123ala' Tue Jun 30 18:59:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp123Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association abi2-arac10-1 2 8 unspecified role unspecified role unspecified role unspecified role C-terminal domain of CFP cCFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 12 unspecified role unspecified role unspecified role unspecified role nVenus-tag nVenus-tag n-venus n-venus n-term range n-terminal range n-term range n-term range n-terminal range n-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association arac10-ropgef4-3 3 7 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait O82481:p.Asp123Ala D123A mutation mutation certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D123A'. Wed May 02 20:25:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp123ala' Tue Jun 30 17:15:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp123Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association