DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu HIV-1 matrix protein p17 promotes angiogenesis via chemokine receptors CXCR1 and CXCR2. HIV-1 matrix protein p17 promotes angiogenesis via chemokine receptors CXCR1 and CXCR2. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Caccuri F., Giagulli C., Bugatti A., Benetti A., Alessandri G., Ribatti D., Marsico S., Apostoli P., Slevin MA., Rusnati M., Guzman CA., Fiorentini S., Caruso A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Caccuri F., Giagulli C., Bugatti A., Benetti A., Alessandri G., Ribatti D., Marsico S., Apostoli P., Slevin MA., Rusnati M., Guzman CA., Fiorentini S., Caruso A. DIP original experiment: DIP-253584X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx HIV-1 matrix protein p17 promotes angiogenesis via chemokine receptors CXCR1 and CXCR2. HIV-1 matrix protein p17 promotes angiogenesis via chemokine receptors CXCR1 and CXCR2. HIV-1 matrix protein p17 promotes angiogenesis via chemokine receptors CXCR1 and CXCR2. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Caccuri F., Giagulli C., Bugatti A., Benetti A., Alessandri G., Ribatti D., Marsico S., Apostoli P., Slevin MA., Rusnati M., Guzman CA., Fiorentini S., Caruso A. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Caccuri F., Giagulli C., Bugatti A., Benetti A., Alessandri G., Ribatti D., Marsico S., Apostoli P., Slevin MA., Rusnati M., Guzman CA., Fiorentini S., Caruso A. DIP original experiment: DIP-253585X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx HIV-1 matrix protein p17 promotes angiogenesis via chemokine receptors CXCR1 and CXCR2. cxcr2_human C-X-C chemokine receptor type 2 CXCR2 IL8RB CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B IL-8 receptor type 2 protein protein human Homo sapiens Human MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL DIP protein P25025 original sequence version: 138 564F04A8BCC0A197 pro_0000042285 Matrix protein p17 gag-pol protein protein hv1b1 Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) HIV-1 GARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSSQVSQNY DIP protein P03366-PRO_0000042285 original sequence version: 173 il8_human Interleukin-8 Protein 3-10C T-cell chemotactic factor CXCL8 C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 Emoctakin Granulocyte chemotactic protein 1 IL8 Monocyte-derived neutrophil chemotactic factor Monocyte-derived neutrophil-activating peptide Neutrophil-activating protein 1 protein protein human Homo sapiens Human MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS DIP protein P10145 original sequence version: 161 15C649996E89319F cxcr2-gag_pol-1 1 4 unspecified role unspecified role prey prey Region 2-132 Region 2-132 polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain Out of date range Feature range: Line: 277, Character: 10: This range position is out of bounds. Actual position : (132-132), sequence length: 131 ecolx Escherichia coli 3 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cxcr2-cxcl8-1 2 5 unspecified role unspecified role prey prey Region 28-99 Region 28-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction