DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251116X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions human Homo sapiens Human saxs x ray scattering saxs predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251099X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251100X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251094X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251098X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions human Homo sapiens Human field flow fractionation field flow fractionation predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251088X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251095X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251108X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251115X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251096X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions ecolx Escherichia coli field flow fractionation field flow fractionation predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251090X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251107X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions ecolx Escherichia coli field flow fractionation field flow fractionation predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251111X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251113X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251091X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251097X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251109X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251112X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro field flow fractionation field flow fractionation predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251092X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251102X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251106X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251093X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251110X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251104X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro field flow fractionation field flow fractionation predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251105X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251101X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251103X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions human Homo sapiens Human light scattering light scattering predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251089X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. Nature structural & molecular biology 2012 imex curation Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Elegheert J., Bracke N., Pouliot P., Gutsche I., Shkumatov AV., Tarbouriech N., Verstraete K., Bekaert A., Burmeister WP., Svergun DI., Lambrecht BN., Vergauwen B., Savvides SN. DIP original experiment: DIP-251114X Nature structural & molecular biology 2012 IMEx Allosteric competitive inactivation of hematopoietic CSF-1 signaling by the viral decoy receptor BARF1. csf1_mouse Macrophage colony-stimulating factor 1 Csf1 Csfm protein protein mouse Mus musculus Mouse MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLESTEQPNHGDRLTEDSQPHPSAGGPVPGVEDILESSLGTNWVLEEASGEASEGFLTQEAKFSPSTPVGGSIQAETDRPRALSASPFPKSTEDQKPVDITDRPLTEVNPMRPIGQTQNNTPEKTDGTSTLREDHQEPGSPHIATPNPQRVSNSATPVAQLLLPKSHSWGIVLPLGELEGKRSTRDRRSPAELEGGSASEGAARPVARFNSIPLTDTGHVEQHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDPQTLDSSVGRPEDSSLTQDEDRQVELPV DIP protein P07141 original sequence version: 88 DIP protein P07141-1 original sequence version: 117 DIP protein P07141 original sequence version: 122 3886D72D70E770AF q8uzd0_9gama protein protein rhesus lymphocryptovirus Macacine gammaherpesvirus 4 MARLFAQLLLLAGSVASCLAVTAFVGERAVLSSYWKRVSLGPEIMVEWFKLGPGEEQTLIGRMHQDVILIEGPFRGFFDMYRSANTFFLILTTANISHDGSYLCRMRLGETEVTKQELLSVVKPLTLSVQAKRSVFPDFSTLNVRCKVNAYPRPYVQWLMPEGADPAPTVTQGEAMKEGDGSLSVVVYLHLHKPWQLPVTCVGKNEKEEVQGVYVSGYVL DIP protein Q8UZD0 original sequence version: 97 csf1r_mouse Macrophage colony-stimulating factor 1 receptor Csf1r Csfmr Fms CSF-1 receptor Proto-oncogene c-Fms protein protein mouse Mus musculus Mouse MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSSDSFFKQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQARLERRDQDYANLPSSGGSSGSDSGGGSSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQFC DIP protein P09581 original sequence version: 115 DIP protein P09581 original sequence version: 149 DIP protein P09581 original sequence version: 160 DIP protein P09581 original sequence version: 156 7EDF8310CCF98906 barf1_ebvb9 Secreted protein BARF1 33 kDa early protein p33 BARF1 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ DIP protein P03228 original sequence version: 58 csf1r_human Macrophage colony-stimulating factor 1 receptor CSF1R FMS Proto-oncogene c-Fms CSF-1 receptor protein protein human Homo sapiens Human MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCAASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQPLLQPNNYQFC DIP protein P07333 original sequence version: 159 DIP protein P07333-1 original sequence version: 185 DIP protein P07333 original sequence version: 145 DIP protein P07333 original sequence version: 148 DIP protein P07333 original sequence version: 153 A8D99BE237573FE8 csf1_human Macrophage colony-stimulating factor 1 CSF1 Lanimostim protein protein human Homo sapiens Human MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLSAQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV DIP protein P09603 original sequence version: 166 DIP protein P09603-1 original sequence version: 127 DIP protein P09603 original sequence version: 130 DIP protein P09603 original sequence version: 139 DIP protein P09603 original sequence version: 135 656B0894F9255AED barf1_ebvb9-1 6 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-csf1-1 3 33 unspecified role unspecified role unspecified role unspecified role P03228:p.[Tyr34Ala;Arg36_Ser39delinsAlaAlaAlaAla] Y34A/R36A/R37A/C38A/S39A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain RRVS AAAA certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:19:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr34ala,arg_arg_val_ser36-39ala_ala_ala_ala' Tue Jun 30 20:11:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr34Ala;Arg36_Ser39delinsAlaAlaAlaAla]' P03228:p.[Tyr34Ala;Arg36_Ser39delinsAlaAlaAlaAla;Arg82_Ser83delinsAlaAla;Asn85_Thr86delinsAlaAla] Y34A/R36A/R37A/C38A/S39A/R82A/S83A/N85A/T86A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain NT AA certain certain sequence position certain certain certain sequence position certain RS AA certain certain sequence position certain certain certain sequence position certain RRVS AAAA certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:06:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr34ala,arg_arg_val_ser36-39ala_ala_ala_ala,arg_ser82-83ala_ala,asn_thr85-86ala_ala' Tue Jun 30 20:07:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr34Ala;Arg36_Ser39delinsAlaAlaAlaAla;Arg82_Ser83delinsAlaAla;Asn85_Thr86delinsAlaAla]' human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-2 17 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-2 28 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-3 2 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction csf1-21 11 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-3 8 30 unspecified role unspecified role prey prey Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role bait bait human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-csf1-4 26 33 unspecified role unspecified role bait bait human Homo sapiens Human 35 unspecified role unspecified role prey prey Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction csf1-22 15 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction csf1-23 13 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-5 19 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction csf1-q8uzd0_9gama-1 20 31 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction csf1-24 18 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction csf1-csf1r-21 27 34 unspecified role unspecified role unspecified role unspecified role Region 21-502 Region 21-502 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P09603:p.[His41Ala;His47Ala;Gln90Ala;Asp91Ala] H41A/H47A/Q90A/D91A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H41A/H47A/Q90A/D91A'. Wed May 02 18:44:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his41ala,his47ala,gln90ala,asp91ala' Tue Jun 30 20:26:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His41Ala;His47Ala;Gln90Ala;Asp91Ala]' P09603:p.Ser30_Ile31insCysLeuGlnArgLeuIleAspCysGlnMetGluThrSer hCSF-mono mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain SI SCLQRLIDCQMETSI Wed May 02 15:18:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_ile30-31ser_cys_leu_gln_arg_leu_ile_asp_cys_gln_met_glu_thr_ser_ile' Tue Jun 30 16:43:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30_Ile31insCysLeuGlnArgLeuIleAspCysGlnMetGluThrSer' ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-6 23 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-csf1-7 22 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-8 24 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-csf1-9 4 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-10 9 32 unspecified role unspecified role unspecified role unspecified role Region 24-503 Region 24-503 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association barf1_ebvb9-csf1-11 25 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction csf1-25 14 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-12 7 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction csf1-26 29 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P09603:p.Ser30_Ile31insCysLeuGlnArgLeuIleAspCysGlnMetGluThrSer hCSF-mono mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain SI SCLQRLIDCQMETSI CLQRLIDCQMETS Wed May 02 15:51:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_ile30-31ser_cys_leu_gln_arg_leu_ile_asp_cys_gln_met_glu_thr_ser_ile' Tue Jun 30 17:07:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30_Ile31insCysLeuGlnArgLeuIleAspCysGlnMetGluThrSer' ecolx Escherichia coli direct interaction direct interaction csf1-27 10 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-13 21 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-csf1-14 16 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-15 5 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction barf1_ebvb9-csf1-16 12 30 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction barf1_ebvb9-csf1-17 1 33 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 35 unspecified role unspecified role unspecified role unspecified role Region 33-181 Region 33-181 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P09603:p.Ser30_Ile31insCysLeuGlnArgLeuIleAspCysGlnMetGluThrSer hCSF-mono mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength insertion analysis insertion analysis certain certain sequence position certain certain certain sequence position certain SI SCLQRLIDCQMETSI Wed May 02 16:07:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_ile30-31ser_cys_leu_gln_arg_leu_ile_asp_cys_gln_met_glu_thr_ser_ile' Tue Jun 30 17:08:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser30_Ile31insCysLeuGlnArgLeuIleAspCysGlnMetGluThrSer' ecolx Escherichia coli direct interaction direct interaction