DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251753X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251750X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251751X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Shim AH., Chang RA., Chen X., Longnecker R., He X. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shim AH., Chang RA., Chen X., Longnecker R., He X. DIP original experiment: DIP-251752X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1. csf1r_mouse Macrophage colony-stimulating factor 1 receptor Csf1r Csfmr Fms CSF-1 receptor Proto-oncogene c-Fms protein protein mouse Mus musculus Mouse MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQKPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRRDSGFSSQGVDTYVEMRPVSTSSSDSFFKQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPTFQQICFLLQEQARLERRDQDYANLPSSGGSSGSDSGGGSSGGSSSEPEEESSSEHLACCEPGDIAQPLLQPNNYQFC DIP protein P09581 original sequence version: 115 DIP protein P09581 original sequence version: 149 DIP protein P09581 original sequence version: 160 DIP protein P09581 original sequence version: 156 7EDF8310CCF98906 barf1_ebvg Secreted protein BARF1 BARF1 33 kDa early protein p33 protein protein ebvg Epstein-Barr virus (strain B95-8) Human herpesvirus 4 MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ DIP protein P0CW72 original sequence version: 11 CA5A24D1EA28758E csf1_human Macrophage colony-stimulating factor 1 CSF1 Lanimostim protein protein human Homo sapiens Human MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPADVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLSAQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV DIP protein P09603 original sequence version: 166 DIP protein P09603-1 original sequence version: 127 DIP protein P09603 original sequence version: 130 DIP protein P09603 original sequence version: 139 DIP protein P09603 original sequence version: 135 656B0894F9255AED barf1-csf1-1 4 6 unspecified role unspecified role unspecified role unspecified role Region 19-221 Region 19-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction barf1-csf1-2 2 6 unspecified role unspecified role unspecified role unspecified role Region 19-221 Region 19-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction csf1-csf1r-20 1 5 unspecified role unspecified role unspecified role unspecified role Region 20-511 Region 20-511 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 7 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction barf1-csf1-3 3 6 unspecified role unspecified role unspecified role unspecified role Region 19-221 Region 19-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role Region 36-182 Region 36-182 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction