IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mapping functional interactions in a heterodimeric phospholipid pump. Mapping functional interactions in a heterodimeric phospholipid pump. The Journal of biological chemistry 2012 imex curation Puts CF., Panatala R., Hennrich H., Tsareva A., Williamson P., Holthuis JC. holthuis@uos.de Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Puts CF., Panatala R., Hennrich H., Tsareva A., Williamson P., Holthuis JC. The mated strains were grown on plates and assessed for positive interaction by growth. Data on chimeric proteins has not been included. There appear to be a number of weak interactions between binary pairs of proteins, but only those the author has regarded as positive have been captured. holthuis@uos.de Accepted 2017-FEB-14 AT 09:40 GMT AT 09:40 GMT by MGT The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation Mapping functional interactions in a heterodimeric phospholipid pump. Mapping functional interactions in a heterodimeric phospholipid pump. The Journal of biological chemistry 2012 imex curation Puts CF., Panatala R., Hennrich H., Tsareva A., Williamson P., Holthuis JC. holthuis@uos.de Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Puts CF., Panatala R., Hennrich H., Tsareva A., Williamson P., Holthuis JC. The mated strains were grown in liquid culture and assessed for positive interaction by expression and activity of beta-galactosidase. Data on chimeric proteins has not been included. There appear to be a number of weak interactions between binary pairs of proteins, but only those the author has regarded as positive have been captured. holthuis@uos.de Accepted 2017-FEB-14 AT 09:40 GMT AT 09:40 GMT by MGT The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation cdc50_yeast Cell division control protein 50 YCR94W YCR094W CDC50 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSLFKRGKAPPLTKEGPTSKKPPNTAFRQQRLKAWQPILSPQSVLPLLIFVACIFTPIGIGLIVSATKVQDLTIDYSHCDTKASTTAFEDIPKKYIKYHFKSKVENKPQWRLTENENGEQSCELQFEIPNDIKKSIFIYYKITNFYQNHRRYVQSFDTKQILGEPIKKDDLDTSCSPIRSREDKIIYPCGLIANSMFNDTFSQVLSGIDDTEDYNLTNKHISWSIDRHRFKTTKYNASDIVPPPNWMKKYPDGYTDENLPDIHTWEEFQVWMRTAAFPKFYKLTLKNESASLPKGKYQMNIELNYPISLFGGTKSFVLTTNGAIGGRNMSLGVLYLIVAGLCALFGIIFLVKLIFQPRAMGDHTYLNFDDEENEDYEDVHAENTTLREIL 565575CA402C0C91 565575CA402C0C91 atc5_yeast Phospholipid-transporting ATPase DNF1 DNF1 YER166W SYGP-ORF7 Flippase DNF1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGTFHGDGHAPMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPKNKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMGTKRNKKGNPIMGRSKTLKWARKNIPNPFEDFTKDDIDPGAINRAQELRTVYYNMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSYRVSADYGRPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPNRPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNRYSVERARTSLDLPGVTNAASLIGTQQNN 3CC3FBA8ADDE8960 3CC3FBA8ADDE8960 atc3_yeast Probable phospholipid-transporting ATPase DRS2 DRS2 FUN38 YAL026C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNDDRETPPKRKPGEDDTLFDIDFLDDTTSHSGSRSKVTNSHANANYIPPSHVLPEETIDLDADDDNIENDVHENLFMSNNHDDQTSWNANRFDSDAYQPQSLRAVKPPGLFARFGNGLKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKILFNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIALFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKPNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMNTLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKYNISDSRPHVQQFQNAIRKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQKRGKYGELQDASANPFNDNNGLGSNDFESAEPFIENPFADGNQNSNRFSSSRDDISFDI 5745B92901F8E1AE 5745B92901F8E1AE yn8s_yeast Probable phospholipid translocase non-catalytic subunit CRF1 CDC50/ROS3 family protein 1 N3453 YNR048W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLILRWKEKKQLSSKQNAQKSRKPANTSFRQQRLKAWQPILSPQSVLPLLILMACVFAPIGIGLVVSTISVQRLVVNYTECDALAPAKHFETIPSEYVDYHFSKKVAVQPQWMVLTDPELGNQTCRIQFEVPNHIKKSTYVYYRLTNFNQNYREYVQSLDLDQLKGKALIGNDLDPNCDPLRTVENKTIFPCGLIANSMFNDTFGTTLTGVNDTADYLLTTKGIAWDTDSHRYGKTEYNASDIVPPPNWAKLFPNGYTDDNIPDLQNWEQFKIWMRTAALPNFYKLAMKNETNGLGKGIYIADIELNYPVRSFYGTKSFVLTTNSIIGAGNEALGIVYLIVAGIATLFAILFLIKVIFKPRPMHDHSYLNFENSDTPFDESSVVSIPLREIL 9BCA199AA3D23969 atc8_yeast Probable phospholipid-transporting ATPase DNF3 DNF3 Aminophospholipid translocase Phospholipid translocase YM8520.11C YMR162C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGIADGQRRRSSSLRTQMFNKHLYDKYRGRTDDEIELEDINESKTFSGSDNNDKDDRDETSGNYAAEEDYEMEEYGSPDVSYSIITKILDTILDRRRTFHSKDGRHIPIILDHNAIEYKQAATKRDGHLIDERFNKPYCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYTLPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNVDLGNSEDNFEDNRDNTNSLRLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPSLDNFPKSRNSIEYKGNSSAIYTGRPSMRSLFGKDNSHLSKQASVISPSETFSENIKSSFDLIQFIQRYPTALFSQKAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIMERLHDRELAAKKMADICTSTKERKDAEAELVLQQRKSLERMVDEEAMARTSLRNSLSSVPRASLSLQAVRKSLSMKNSRTRDPEKQIDSIDQFLETVKKSDQEIGSVVNKSRKSLHKQQIEKYGPRISIDGTHFPNNNVPIDTRKEGLQHDYDTEILEHIGSDELILNEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVILTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSLSDNTMYPLGLINFTAIVALINVKSQFVEMHNRNWLAFTSVVLSCGGWLVWCCALPILNNTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQKSDIRKKLELGAYSEMRQGWTWDKDPSTFTRYTDKVLSRPRTNSRASAKTHNSSIYSMSNGNVDHSSKKNFFGNSSKKSSERYEVLPSGKLIKRPSLKTQSSKDSIGGNITTKLTKKLKLPSRNVEDEDVNQIIQARLKDLE A20A823BEB401184 lem3_yeast Alkylphosphocholine resistance protein LEM3 LEM3 BRE3 Ro-sensitive 3 Brefeldin-A sensitivity protein 3 ROS3 N0333 YNL323W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVNFDLGQVGEVFRRKDKGAIVSGDNPEEEEDVDASEFEEDEVKPVRTKNRRPKEDAFTQQRLAAINPVLTPRTVLPLYLLIAVVFVIVGGCILAQNSKVDEVTIYYQDCMTNATSSWSDIPSEHWQFVFHKYKTYNTAPQWRFVDDESDDFTKQRGTCQIRFTTPSDMKNNVYLNYVLEKFAANHRRYVLSFSEDQIRGEDASYETVHDATGINCKPLSKNADGKIYYPCGLIANSMFNDTFPLQLTNVGDTSNNYSLTNKGINWESDKKRYKKTKYNYTQIAPPPYWEKMYPDGYNETNIPDIQDWEEFQNWMRPGAFDKITKLIRINKNDTLPAGEYQLDIGLHWPVLEFNGKKGIYLTHGSHLGGRNPFLGIVYLIGGCICAAMALILLTFWLFGGRKIADASSLSWNMK 55BDA1F32251B4E6 55BDA1F32251B4E6 dnf1-lem3-5 1 4 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey P42838:p.Cys159Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:10:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys159ala' Tue Jun 30 17:28:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys159Ala' P42838:p.Cys216Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:44:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys216ala' Tue Jun 30 19:54:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys216Ala' region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42838:p.Ala83Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A T Wed May 02 18:21:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala83thr' Tue Jun 30 17:33:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala83Thr' P42838:p.Ser237Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S L Wed May 02 17:15:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser237leu' Tue Jun 30 18:42:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser237Leu' P42838:p.Gly375Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G E Wed May 02 16:27:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly375glu' Tue Jun 30 16:06:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly375Glu' P42838:p.Ala404Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A V Wed May 02 17:13:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala404val' Tue Jun 30 18:33:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala404Val' P42838:p.Cys110Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:58:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys110ala' Tue Jun 30 16:55:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys110Ala' P42838:p.Cys231Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:27:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys231ala' Tue Jun 30 19:31:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys231Ala' physical association physical association Fig. 1B, 2A, 8C cdc50-drs2-2 1 3 unspecified role unspecified role prey prey P25656:p.Cys80Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:26:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys80ala' Tue Jun 30 17:00:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys80Ala' P25656:p.Cys123Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:05:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys123ala' Tue Jun 30 17:19:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys123Ala' P25656:p.Cys176Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:05:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys176ala' Tue Jun 30 17:21:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys176Ala' P25656:p.Cys190Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:54:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys190ala' Tue Jun 30 19:45:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys190Ala' region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P39524:p.Glu342Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E Q Wed May 02 15:35:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu342gln' Tue Jun 30 15:38:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu342Gln' P39524:p.Asp560Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:05:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp560asn' Tue Jun 30 17:32:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp560Asn' P39524:p.Gly341Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G L Wed May 02 19:18:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly341leu' Tue Jun 30 15:36:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly341Leu' physical association physical association Fig. 2A, 2B, 4A, 4C, 6A, 8A dnf3-yn8s-1 1 6 unspecified role unspecified role prey prey P53740:p.Cys82Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:01:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys82ala' Tue Jun 30 19:41:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys82Ala' P53740:p.Cys126Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 17:56:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys126ala' Tue Jun 30 16:14:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys126Ala' P53740:p.Cys179Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:16:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys179ala' Tue Jun 30 17:50:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys179Ala' P53740:p.Cys193Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 16:40:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys193ala' Tue Jun 30 18:42:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys193Ala' region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2A, 2B, 4A, 8B dnf1-lem3-6 2 4 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42838:p.Ala83Thr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A T Wed May 02 18:14:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala83thr' Tue Jun 30 18:19:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala83Thr' P42838:p.Ser237Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S L Wed May 02 18:01:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser237leu' Tue Jun 30 19:34:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser237Leu' P42838:p.Gly375Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G E Wed May 02 14:39:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly375glu' Tue Jun 30 17:08:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly375Glu' P42838:p.Ala404Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A V Wed May 02 16:25:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala404val' Tue Jun 30 17:37:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala404Val' P42838:p.Ala65Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A V Wed May 02 14:54:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala65val' Tue Jun 30 17:43:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala65Val' physical association physical association Fig. 1D Mutant data from 8D not included as wild-type not shown dnf3-yn8s_yeast-2 2 6 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B drs2-cdc50-3 2 3 unspecified role unspecified role prey prey region nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B