DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. Nature structural & molecular biology 2012 imex curation Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. DIP original experiment: DIP-255469X Nature structural & molecular biology 2012 IMEx LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. Nature structural & molecular biology 2012 imex curation Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. DIP original experiment: DIP-255470X Nature structural & molecular biology 2012 IMEx LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. Nature structural & molecular biology 2012 imex curation Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. DIP original experiment: DIP-255465X Nature structural & molecular biology 2012 IMEx LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. Nature structural & molecular biology 2012 imex curation Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. DIP original experiment: DIP-255467X Nature structural & molecular biology 2012 IMEx LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. Nature structural & molecular biology 2012 imex curation Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. DIP original experiment: DIP-255466X Nature structural & molecular biology 2012 IMEx LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. Nature structural & molecular biology 2012 imex curation Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. DIP original experiment: DIP-255464X Nature structural & molecular biology 2012 IMEx LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. LEDGF (p75) promotes DNA-end resection and homologous recombination. Nature structural & molecular biology 2012 imex curation Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Daugaard M., Baude A., Fugger K., Povlsen LK., Beck H., Sørensen CS., Petersen NH., Sorensen PH., Lukas C., Bartek J., Lukas J., Rohde M., Jäättelä M. DIP original experiment: DIP-255468X Nature structural & molecular biology 2012 IMEx LEDGF (p75) promotes DNA-end resection and homologous recombination. h3k9-2 Histone H3 N-terminal Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQLA psip1_human PC4 and SFRS1-interacting protein PSIP1 DFS70 LEDGF PSIP2 Lens epithelium-derived growth factor Transcriptional coactivator p75/p52 Dense fine speckles 70 kDa protein CLL-associated antigen KW-7 protein protein human Homo sapiens Human MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN DIP protein O75475 original sequence version: 124 DIP protein O75475-1 original sequence version: 108 DIP protein O75475-1 original sequence version: 113 DIP protein O75475 original sequence version: 113 4B653D02B1D0E174 ctip_human DNA endonuclease RBBP8 RBBP8 CTIP CtBP-interacting protein Retinoblastoma-binding protein 8 Retinoblastoma-interacting protein and myosin-like Sporulation in the absence of SPO11 protein 2 homolog protein protein human Homo sapiens Human MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFFTKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQKIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTRNTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSLLQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQNRTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKPLDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVLDDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDKVKQKAFVEPYFKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRFRYIPPNTPENFWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT DIP protein Q99708 original sequence version: 111 DIP protein Q99708 original sequence version: 92 DIP protein Q99708-1 original sequence version: 138 DIP protein Q99708 original sequence version: 150 DIP protein Q99708 original sequence version: 110 DIP protein Q99708-1 original sequence version: 110 E028DE56DE55C0F2 h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY DIP protein P16104 original sequence version: 114 DIP protein P16104 original sequence version: 110 DIP protein P16104 original sequence version: 117 DIP protein P16104 original sequence version: 133 DIP protein P16104 original sequence version: 140 DIP protein P16104 original sequence version: 113 DIP protein P16104 original sequence version: 99 D4683775C2E6C3A9 rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 h3k27me Histone 3 fragment [ATKAARKSAPATGGVKKPHRYRPG] peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ATKAARKSAPATGGVKKPHRYRPG psip1-rbbp8-1 6 10 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association psip1-rbbp8-2 4 10 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association h3k4-psip1-1 1 8 unspecified role unspecified role bait bait K4me1 K4me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro 9 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association psip1-rbbp8-3 3 10 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction rbbp8-h2afx-1 7 11 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association rbbp8-psip1-1 5 9 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association h3k36-psip1-1 2 13 unspecified role unspecified role bait bait K36me1 K36me1 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain K36me2 K36me2 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain K36me3 K36me3 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro 9 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association