DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and permeation mechanism of a mammalian urea transporter. Structure and permeation mechanism of a mammalian urea transporter. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Levin EJ., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Levin EJ., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M. DIP original experiment: DIP-251674X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and permeation mechanism of a mammalian urea transporter. Structure and permeation mechanism of a mammalian urea transporter. Structure and permeation mechanism of a mammalian urea transporter. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Levin EJ., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Levin EJ., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M. DIP original experiment: DIP-251675X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and permeation mechanism of a mammalian urea transporter. Structure and permeation mechanism of a mammalian urea transporter. Structure and permeation mechanism of a mammalian urea transporter. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Levin EJ., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Levin EJ., Cao Y., Enkavi G., Quick M., Pan Y., Tajkhorshid E., Zhou M. DIP original experiment: DIP-251673X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and permeation mechanism of a mammalian urea transporter. q5qf96-1 Urea transporter 1 SLC14A1 UT-B Solute carrier family 14 member 1 Urea transporter B Urea transporter, erythrocyte UT-B1 protein protein bovin Bos taurus (Bovine) Bovine MDDNPTAVKLDQGGNQAPQGRGRRCLPKALGYITGDMKEFANWLKDKPQALQFVDWVLRGISQVVFVSNPISGILILVGLLVQNPWCALNGCVGTVVSTLTALLLSQDRSAITAGLQGYNATLVGILMAIYSDKGNYFWWLLFPVSAMSMTCPVFSSALNSVLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPSTLITPVTSVPNVTWPDLSALQLLKSLPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIIAGLSLSAPFEDIYAGLWGFNSSLACIAIGGTFMALTWQTHLLALACALFTAYLGASMSHVMAVVGLPSGTWPFCLATLLFLLLTTKNPNIYKMPISKVTYPEENRIFYLQSRKRTVQGPL DIP protein Q5QF96-1 original sequence version: 43 q13336-1 Urea transporter 1 SLC14A1 HUT11 JK RACH1 UT1 UTE Solute carrier family 14 member 1 Urea transporter, erythrocyte protein protein human Homo sapiens Human MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVVFVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKGDYFWWLLLPVCAMSMTCPIFSSALNSMLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEDIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL DIP protein Q13336-1 original sequence version: 114 slc14a1-1 3 4 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction slc14a1-2 1 5 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction slc14a1-3 2 4 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction