DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions human Homo sapiens Human bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250539X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250546X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250544X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250542X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250543X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250541X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250545X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. PLoS biology 2011 imex curation González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. Only protein-protein interactions human Homo sapiens Human bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret predetermined predetermined participant predetermined González S., Moreno-Delgado D., Moreno E., Pérez-Capote K., Franco R., Mallol J., Cortés A., Casadó V., Lluís C., Ortiz J., Ferré S., Canela E., McCormick PJ. DIP original experiment: DIP-250540X PLoS biology 2011 IMEx Circadian-related heteromerization of adrenergic and dopamine D₄ receptors modulates melatonin synthesis and release in the pineal gland. adrb1_rat Beta-1 adrenergic receptor Beta-1 adrenoreceptor Adrb1 Adrb1r protein protein rat Rattus norvegicus (Rat) Rat MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAGMGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDDDDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV DIP protein P18090 original sequence version: 111 2955CB024944A12B drd4_human D(4) dopamine receptor DRD4 D(2C) dopamine receptor Dopamine D4 receptor protein protein human Homo sapiens Human MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVATERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSGPGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPGLPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC DIP protein P21917 original sequence version: 120 mint 34CBE8320302008E drd4_rat D(4) dopamine receptor Drd4 D(2C) dopamine receptor Dopamine D4 receptor protein protein rat Rattus norvegicus (Rat) Rat MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASERILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASIFNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVCCLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPVSDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRKRGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVNSALNPIIYTIFNAEFRSVFRKTLRLRC DIP protein P30729 original sequence version: 95 ada1b_rat Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor Adra1b protein protein rat Rattus norvegicus (Rat) Rat MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGTQRTLPSASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGDPESPGTEGDTSNGGCDTTTDLANGQPGFKSNMPLAPGHF DIP protein P15823 original sequence version: 97 AF0C3759F80C3135 adrb1_human Beta-1 adrenergic receptor Beta-1 adrenoreceptor ADRB1 ADRB1R B1AR protein protein human Homo sapiens Human MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV DIP protein P08588 original sequence version: 119 DIP protein P08588 original sequence version: 133 0950F2684E4721B8 ada1b_human Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor ADRA1B protein protein human Homo sapiens Human MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF DIP protein P35368 original sequence version: 106 F081A23D2F943F7F drd4-adra1b-1 6 10 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association drd4-adra1b-2 1 10 unspecified role unspecified role fluorescence donor fluorescence donor Rluc-tag Rluc-tag renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 14 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction adra1b-drd4-1 2 12 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat proximity proximity close-contact colocalization neighbourhood interaction drd4-adra1b-3 3 12 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association adrb1-drd4-1 7 9 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role unspecified role unspecified role rat Rattus norvegicus (Rat) Rat proximity proximity close-contact colocalization neighbourhood interaction drd4-adrb1-1 4 10 unspecified role unspecified role bait bait YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association drd4-adrb1-2 8 10 unspecified role unspecified role fluorescence donor fluorescence donor Rluc-tag Rluc-tag renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human 13 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human proximity proximity close-contact colocalization neighbourhood interaction drd4-adrb1-3 5 9 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association