DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu PGC7 binds histone H3K9me2 to protect against conversion of 5mC to 5hmC in early embryos. PGC7 binds histone H3K9me2 to protect against conversion of 5mC to 5hmC in early embryos. Nature 2012 imex curation Nakamura T., Liu YJ., Nakashima H., Umehara H., Inoue K., Matoba S., Tachibana M., Ogura A., Shinkai Y., Nakano T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nakamura T., Liu YJ., Nakashima H., Umehara H., Inoue K., Matoba S., Tachibana M., Ogura A., Shinkai Y., Nakano T. DIP original experiment: DIP-250644X Nature 2012 IMEx PGC7 binds histone H3K9me2 to protect against conversion of 5mC to 5hmC in early embryos. dppa3_mouse Developmental pluripotency-associated protein 3 Dppa3 Cap1p Crg1 Pgc7 Compaction-associated protein 1 Primordial germ cell protein 7 protein protein mouse Mus musculus Mouse MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN DIP protein Q8QZY3 original sequence version: 64 h3k9-2 Histone H3 N-terminal Peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ARTKQTARKSTGGKAPRKQLA h3 (121)-dppa3-1 1 3 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal in vitro In vitro 2 unspecified role unspecified role prey prey N-terminal domain Region 1-75 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction