DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structure (London, England : 1993) 2012 imex curation Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. DIP original experiment: DIP-250468X Structure (London, England : 1993) 2012 IMEx Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structure (London, England : 1993) 2012 imex curation Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. DIP original experiment: DIP-250470X Structure (London, England : 1993) 2012 IMEx Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structure (London, England : 1993) 2012 imex curation Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. DIP original experiment: DIP-250469X Structure (London, England : 1993) 2012 IMEx Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structure (London, England : 1993) 2012 imex curation Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. DIP original experiment: DIP-250471X Structure (London, England : 1993) 2012 IMEx Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structural insights into the role of domain flexibility in human DNA ligase IV. Structure (London, England : 1993) 2012 imex curation Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Ochi T., Wu Q., Chirgadze DY., Grossmann JG., Bolanos-Garcia VM., Blundell TL. DIP original experiment: DIP-250467X Structure (London, England : 1993) 2012 IMEx Structural insights into the role of domain flexibility in human DNA ligase IV. q9h9q4-1 Non-homologous end-joining factor 1 NHEJ1 XLF Protein cernunnos XRCC4-like factor protein protein human Homo sapiens Human MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS DIP protein Q9H9Q4-1 original sequence version: 69 DIP protein Q9H9Q4-1 original sequence version: 86 DIP protein Q9H9Q4-1 original sequence version: 84 dnli4_human DNA ligase 4 DNA ligase IV Polydeoxyribonucleotide synthase [ATP] 4 LIG4 protein protein human Homo sapiens Human MAASQTSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHGDAGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGKASGKLASKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI DIP protein P49917 original sequence version: 127 DIP protein P49917 original sequence version: 151 DIP protein P49917 original sequence version: 144 2122813E1EFA63B9 q13426-2 DNA repair protein XRCC4 XRCC4 X-ray repair cross-complementing protein 4 protein protein human Homo sapiens Human MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKEKPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI DIP protein Q13426-2 original sequence version: 99 DIP protein Q13426-2 original sequence version: 115 lig4-nhej1-4 5 6 unspecified role unspecified role unspecified role unspecified role Region 1-233 Region 1-233 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 8 unspecified role unspecified role unspecified role unspecified role Region 1-213 Region 1-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 654-911 Region 654-911 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association lig4-xrcc4-16 3 8 unspecified role unspecified role unspecified role unspecified role Region 1-213 Region 1-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 654-911 Region 654-911 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lig4-xrcc4-17 4 8 unspecified role unspecified role prey prey Region 1-213 Region 1-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role bait bait Region 245-911 Region 245-911 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association lig4-xrcc4-18 1 8 unspecified role unspecified role unspecified role unspecified role Region 1-213 Region 1-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 654-911 Region 654-911 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction lig4-xrcc4-19 2 8 unspecified role unspecified role prey prey Region 1-213 Region 1-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role bait bait Region 654-911 Region 654-911 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association