IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. Histochemistry and cell biology 2012 imex curation Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Accepted 2017-OCT-30 AT 10:22 GMT AT 10:22 GMT by ORCHARD Human full-length cDNA library Histochemistry and cell biology 2012 imex curation CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. Histochemistry and cell biology 2012 imex curation Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Accepted 2017-OCT-30 AT 10:22 GMT AT 10:22 GMT by ORCHARD Histochemistry and cell biology 2012 imex curation CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. Histochemistry and cell biology 2012 imex curation Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Accepted 2017-OCT-30 AT 10:22 GMT AT 10:22 GMT by ORCHARD Histochemistry and cell biology 2012 imex curation CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. Histochemistry and cell biology 2012 imex curation Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Accepted 2017-OCT-30 AT 10:22 GMT AT 10:22 GMT by ORCHARD Histochemistry and cell biology 2012 imex curation CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. Histochemistry and cell biology 2012 imex curation Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Accepted 2017-OCT-30 AT 10:22 GMT AT 10:22 GMT by ORCHARD Histochemistry and cell biology 2012 imex curation CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. Histochemistry and cell biology 2012 imex curation Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Huang J., Zhang L., Liu W., Liao Q., Shi T., Xiao L., Hu F., Qiu X. Some results from fig 4A have not been entered as the origin of Flag-PCAF cannot be traced. hADA2a was found to correspond to the gene TADA2A from Blat of primers in Ref Huang-2011 (no pmid). CCDC134 and myc/his tagged version were found to be of Human origin from Huang-2008 (pmid:18087676) not from Ref Haung-2011. qiuxy@bjmu.edu.cn Accepted 2017-OCT-30 AT 10:22 GMT AT 10:22 GMT by ORCHARD Histochemistry and cell biology 2012 imex curation tad2a_human Transcriptional adapter 2-alpha TADA2A TADA2L Transcriptional adapter 2-like KL04P protein protein human Homo sapiens Human MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPSIPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG A4E1D87B1B3F6BA5 tada3_human Transcriptional adapter 3 ADA3 homolog STAF54 TADA3 ADA3 TADA3L Transcriptional adapter 3-like protein protein human Homo sapiens Human MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSEDDGIGIEELDTLQLELETLLSSASRRLRVLEAETQILTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQKLEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPIDVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEELLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQKDGARAAAVADKKKGLMGPLTELDTKDVDALLKKSEAQHEQPEDGCPFGALTQRLLQALVEENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG C86153CFA83F9226 cc134_human Coiled-coil domain-containing protein 134 CCDC134 protein protein human Homo sapiens Human MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL F14C6797854B0598 ccdc134-tada2a-5 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Supp fig 1A ccdc134-tada2a-1 2 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Supp fig 1B These results suggested that full- length CCDC134 specifically interacted with hADA2a. ccdc134-tada2a-2 3 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2A-2 tada2a-ccdc134-3 6 7 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2A Western blot analysis revealed that pcDB-CCDC134-myc/his coprecipitated with hADA2a- GFP. ccdc134-tada2a-3 5 7 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2B the full-length form of hADA2a that was generated and labeled with biotin by an in vitro tran- scription/translation system was pulled down by the recombinant GST-CCDC134 fusion protein ccdc134-tada2a-4 4 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 2C, 5D CCDC134 and hADA2a colocalized partly and showed a relatively diffuse nuclear distribution pattern in U-2 OS UV irradiation tada3-ccdc134-1 3 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 4A