DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250437X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250438X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250432X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250435X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250433X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250434X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250436X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250439X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. Structure (London, England : 1993) 2012 imex curation Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Boura E., Różycki B., Chung HS., Herrick DZ., Canagarajah B., Cafiso DS., Eaton WA., Hummer G., Hurley JH. DIP original experiment: DIP-250431X Structure (London, England : 1993) 2012 IMEx Solution structure of the ESCRT-I and -II supercomplex: implications for membrane budding and scission. mvb12_yeast Multivesicular body sorting factor 12 YGR206W G7740 12 kDa multivesicular body sorting factor ESCRT-I complex subunit MVB12 MVB12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQLHDSSNKKFDQWYKEQYLSKKPPGIVGNTLLSPSRKDNS E48B085E0FACBAC8 E48B085E0FACBAC8 srn2_yeast Protein SRN2 SRN2 ESCRT-I complex subunit VPS37 SRN10 Vacuolar protein sorting-associated protein 37 VPS37 L2958 L9233.5 YLR119W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKVKATKLRIKQRRKNKGLNISRLDIIRAEMDVVPSPGLPEKVNEKSKNIPLPEGINLLSSKEIIDLIQTHRHQLELYVTKFNPLTDFAGKIHAFRDQFKQLEENFEDLHEQKDKVQALLENCRILESKYVASWQDYHSEFSKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREKLATWDKQGNLKY 4E99806CED03E345 4E99806CED03E345 vps25_yeast Vacuolar protein-sorting-associated protein 25 YJR102C J1957 VPS25 VPT25 ESCRT-II complex subunit VPS25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSALPPVYSFPPLYTRQPNSLTRRQQISTWIDIISQYCKTKKIWYMSVDGTVINDNELDSGSTDNDDSKKISKNLFNNEDIQRSVSQVFIDEIWSQMTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVITLYELSEGDETVNWEFHRMPESLLYYCLKPLCDRNRATMLKDENDKVIAIKVV 6A4545A8BC772CA2 6A4545A8BC772CA2 vps36_yeast Vacuolar protein-sorting-associated protein 36 VPS36 GRD12 VAC3 VPL11 YLR417W ESCRT-II complex subunit VPS36 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSKDELGKSAETASADVVSTWVCPICMVSNETQGEFTKDTLPTPICINCGVPADYELTKSSINCSNAIDPNANPQNQFGVNSENICPACTFANHPQIGNCEICGHRLPNASKVRSKLNRLNFHDSRVHIELEKNSLARNKSSHSALSSSSSTGSSTEFVQLSFRKSDGVLFSQATERALENILTEKNKHIFNQNVVSVNGVDMRKGASSHEYNNEVPFIETKLSRIGISSLEKSRENQLLNNDILFNNALTDLNKLMSLATSIERLYKNSNITMKTKTLNLQDESTVNEPKTRRPLLILDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPSHI 60DDD4EA3A620409 60DDD4EA3A620409 snf8_yeast Vacuolar-sorting protein SNF8 Vacuolar protein-sorting-associated protein 22 SNF8 ESCRT-II complex subunit VPS22 VPS22 YPL002C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKQFGLAAFDELKDGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQL 212C74F086A0325E 212C74F086A0325E vps28_yeast Vacuolar protein sorting-associated protein 28 VPS28 VPT28 YPL065W LPE5W ESCRT-I complex subunit VPS28 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQKHNIKLNQNQDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFCDTYNITASNAITRLERGIPITAEHAISTTTSAPSGDNKQSSSSDKKFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD DE091D3F60C9D132 DE091D3F60C9D132 stp22_yeast Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease STP22 VPS23 YCL008C YCL8C Vacuolar protein sorting-associated protein 23 ESCRT-I complex subunit VPS23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSANGKISVPEAVVNWLFKVIQPIYNDGRTTFHDSLALLDNFHSLRPRTRVFTHSDGTPQLLLSIYGTISTGEDGSSPHSIPVIMWVPSMYPVKPPFISINLENFDMNTISSSLPIQEYIDSNGWIALPILHCWDPAAMNLIMVVQELMSLLHEPPQDQAPSLPPKPNTQLQQEQNTPPLPPKPKSPHLKPPLPPPPPPQPASNALDLMDMDNTDISPTNHHEMLQNLQTVVNELYREDVDYVADKILTRQTVMQESIARFHEIIAIDKNHLRAVEQAIEQTMHSLNAQIDVLTANRAKVQQFSSTSHVDDEDVNSIAVAKTDGLNQLYNLVAQDYALTDTIECLSRMLHRGTIPLDTFVKQGRELARQQFLVRWHIQRITSPLS FEDE3BE79F063BCE FEDE3BE79F063BCE vps36-vps22-1 9 12 unspecified role unspecified role prey prey ecolx Escherichia coli 14 unspecified role unspecified role prey prey ecolx Escherichia coli 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association vps23-mvb12-2 5 10 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association vps36-vps22-2 2 14 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa594-label Alexa594-label alexa 594 label alexa 594 label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role fluorescence donor fluorescence donor Alexa488-label Alexa488-label alexa 488 label alexa 488 label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vps22-vps25-1 4 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association vps22-vps25-2 3 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association vps23-vps37-2 8 11 unspecified role unspecified role unspecified role unspecified role MTSL-label MTSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role MTSL-label MTSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mvb12-vps23-3 6 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association vps36-vps22-3 1 14 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa594-label Alexa594-label alexa 594 label alexa 594 label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role fluorescence donor fluorescence donor Alexa488-label Alexa488-label alexa 488 label alexa 488 label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mvb12-vps22-1 7 13 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association