DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250461X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250456X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250459X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250458X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250454X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250455X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper saxs x ray scattering saxs predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250457X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structural and functional analysis of HtrA1 and its subdomains. Structure (London, England : 1993) 2012 imex curation Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. Only protein-protein interactions in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Eigenbrot C., Ultsch M., Lipari MT., Moran P., Lin SJ., Ganesan R., Quan C., Tom J., Sandoval W., van Lookeren Campagne M., Kirchhofer D. DIP original experiment: DIP-250460X Structure (London, England : 1993) 2012 IMEx Structural and functional analysis of HtrA1 and its subdomains. ibp1_human Insulin-like growth factor-binding protein 1 IGFBP1 IBP1 Placental protein 12 protein protein human Homo sapiens Human MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN DIP protein P08833 original sequence version: 172 DIP protein P08833 original sequence version: 147 8AA75AF7DC966012 igf1_human Insulin-like growth factor I IGF1 IBP1 Somatomedin-C Mechano growth factor protein protein human Homo sapiens Human MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK DIP protein P05019 original sequence version: 130 DIP protein P05019 original sequence version: 178 DIP protein P05019 original sequence version: 140 DIP protein P05019 original sequence version: 186 DIP protein P05019 original sequence version: 151 The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation mint E88A8CFBD1CD1873 htra1_human Serine protease HTRA1 HTRA1 HTRA PRSS11 High-temperature requirement A serine peptidase 1 L56 Serine protease 11 protein protein human Homo sapiens Human MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP DIP protein Q92743 original sequence version: 106 DIP protein Q92743 original sequence version: 149 DIP protein Q92743 original sequence version: 119 CA20A99480FB2330 ibp3_human Insulin-like growth factor-binding protein 3 IGFBP3 IBP3 protein protein human Homo sapiens Human MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK DIP protein P17936 original sequence version: 147 A9682065AB266586 p01344-1 Insulin-like growth factor II IGF2 Somatomedin-A T3M-11-derived growth factor PP1446 protein protein human Homo sapiens Human MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK DIP protein P01344-1 original sequence version: 113 DIP protein P01344-1 original sequence version: 166 Product of 5 different transcripts regulated by 5 different promoters, denominated P0, P1, P2, P3 and P4. htra1-7 7 11 unspecified role unspecified role unspecified role unspecified role Mature protein Region 23-480 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction htra1-8 5 11 unspecified role unspecified role unspecified role unspecified role Catalytic domain Region 161-379 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction igf1-igfbp1-2 4 10 unspecified role unspecified role bait bait Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role prey prey Region 26-259 Region 26-259 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse direct interaction direct interaction htra1-9 6 11 unspecified role unspecified role unspecified role unspecified role Catalytic domain Region 161-379 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction igf2-igfbp1-1 8 13 unspecified role unspecified role bait bait Region 25-91 Region 25-91 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role prey prey Region 26-259 Region 26-259 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse direct interaction direct interaction htra1-10 2 11 unspecified role unspecified role unspecified role unspecified role Region 23-376 Region 23-376 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction igf1-igfbp3-1 3 10 unspecified role unspecified role bait bait Region 49-118 Region 49-118 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role prey prey Region 28-291 Region 28-291 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse direct interaction direct interaction igf2-igfbp3-1 1 12 unspecified role unspecified role prey prey Region 28-291 Region 28-291 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 13 unspecified role unspecified role bait bait Region 25-91 Region 25-91 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction