DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Methionine scanning as an NMR tool for detecting and analyzing biomolecular interaction surfaces. Methionine scanning as an NMR tool for detecting and analyzing biomolecular interaction surfaces. Structure (London, England : 1993) 2012 imex curation Stoffregen MC., Schwer MM., Renschler FA., Wiesner S. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Stoffregen MC., Schwer MM., Renschler FA., Wiesner S. DIP original experiment: DIP-249302X Structure (London, England : 1993) 2012 IMEx Methionine scanning as an NMR tool for detecting and analyzing biomolecular interaction surfaces. rsp5_yeast E3 ubiquitin-protein ligase RSP5 RSP5 MDP1 NPI1 YER125W SYGP-ORF41 Reverses SPT-phenotype protein 5 HECT-type E3 ubiquitin transferase RSP5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSSISVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTSAAKKTLNPYWNETFKFDDINENSILTIQVFDQKKFKKKDQGFLGVVNVRVGDVLGHLDEDTATSSGRPREETITRDLKKSNDGMAVSGRLIVVLSKLPSSSPHSQAPSGHTASSSTNTSSTTRTNGHSTSSTRNHSTSHPSRGTAQAVESTLQSGTTAATNTATTSHRSTNSTSSATRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTEAERGNQLNANTELERRQHRGRTLPGGSSDNSSVTVQVGGGSNIPPVNGAAAAAFAATGGTTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEETIGFGQE 6F1836384479E70F 6F1836384479E70F ubc4_yeast Ubiquitin-conjugating enzyme E2 4 UBC4 YBR082C YBR0745 Ubiquitin-protein ligase 4 Ubiquitin carrier protein 4 E2 ubiquitin-conjugating enzyme 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYAV 8E96137D3EB20F80 8E96137D3EB20F80 rsp5p-ubc4-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role Region 425-809 Region 425-809 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P39940:p.Trp597Met W597M mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W M This feature has been corrected as a result of our quality control procedures. The original label was 'W597M'. Wed May 02 20:32:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp597met' Tue Jun 30 17:07:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp597Met' P39940:p.Ser594Met S594M mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S M This feature has been corrected as a result of our quality control procedures. The original label was 'S594M'. Wed May 02 16:58:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser594met' Tue Jun 30 19:05:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser594Met' P39940:p.Leu607Met L607M mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L M This feature has been corrected as a result of our quality control procedures. The original label was 'L607M'. Wed May 02 17:23:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu607met' Tue Jun 30 15:46:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu607Met' P39940:p.Asp614Met D614M mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D M This feature has been corrected as a result of our quality control procedures. The original label was 'D614M'. Wed May 02 19:21:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp614met' Tue Jun 30 19:50:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp614Met' P39940:p.Tyr647Met Y647M mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y M This feature has been corrected as a result of our quality control procedures. The original label was 'Y647M'. Wed May 02 17:55:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr647met' Tue Jun 30 19:08:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr647Met' ecolx Escherichia coli direct interaction direct interaction