DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response. The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response. Nature 2012 imex curation Sanada T., Kim M., Mimuro H., Suzuki M., Ogawa M., Oyama A., Ashida H., Kobayashi T., Koyama T., Nagai S., Shibata Y., Gohda J., Inoue J., Mizushima T., Sasakawa C. Only protein-protein interactions in vitro In vitro deamination deamination assay aminase assay deamination predetermined predetermined participant predetermined Sanada T., Kim M., Mimuro H., Suzuki M., Ogawa M., Oyama A., Ashida H., Kobayashi T., Koyama T., Nagai S., Shibata Y., Gohda J., Inoue J., Mizushima T., Sasakawa C. DIP original experiment: DIP-249461X Nature 2012 IMEx The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response. The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response. The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response. Nature 2012 imex curation Sanada T., Kim M., Mimuro H., Suzuki M., Ogawa M., Oyama A., Ashida H., Kobayashi T., Koyama T., Nagai S., Shibata Y., Gohda J., Inoue J., Mizushima T., Sasakawa C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sanada T., Kim M., Mimuro H., Suzuki M., Ogawa M., Oyama A., Ashida H., Kobayashi T., Koyama T., Nagai S., Shibata Y., Gohda J., Inoue J., Mizushima T., Sasakawa C. DIP original experiment: DIP-249462X Nature 2012 IMEx The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response. q8vsd5_shifl ORF169b SF_p0209 protein protein shifl Shigella flexneri MINGVSLQGTAGYEAHTEEGNVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNCSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC DIP protein Q8VSD5 original sequence version: 36 ube2n_human Ubiquitin-conjugating enzyme E2 N Ubiquitin-protein ligase N Ubiquitin carrier protein N Ubc13 Bendless-like ubiquitin-conjugating enzyme UBE2N BLU UbcH13 E2 ubiquitin-conjugating enzyme N protein protein human Homo sapiens Human MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI DIP protein P61088 original sequence version: 137 DIP protein P61088 original sequence version: 105 DIP protein P61088 original sequence version: 60 DIP protein P61088 original sequence version: 64 DIP protein P61088 original sequence version: 85 FACD84D883D77407 orf169b-ube2n-1 1 3 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 4 enzyme target enzyme target substrate substrate unspecified role unspecified role Q100 Q100 dngln deamidated L-glutamine (2S)-2-aminopentanedioic acid 1-aminopropane-1,3-dicarboxylic acid 2-aminoglutaric acid 2-azanylpentanedioic acid L-glutamic acid MOD_RES Deamidated glutamine alpha-aminoglutaric acid glutaminic acid dNGln modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli deamination deamination reaction deamination ube2n-orf169b-1 2 4 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 3 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction