DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural dynamics associated with intermediate formation in an archetypal conformational disease. Structural dynamics associated with intermediate formation in an archetypal conformational disease. Structure (London, England : 1993) 2012 imex curation Nyon MP., Segu L., Cabrita LD., Lévy GR., Kirkpatrick J., Roussel BD., Patschull AO., Barrett TE., Ekeowa UI., Kerr R., Waudby CA., Kalsheker N., Hill M., Thalassinos K., Lomas DA., Christodoulou J., Gooptu B. Only protein-protein interactions in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Nyon MP., Segu L., Cabrita LD., Lévy GR., Kirkpatrick J., Roussel BD., Patschull AO., Barrett TE., Ekeowa UI., Kerr R., Waudby CA., Kalsheker N., Hill M., Thalassinos K., Lomas DA., Christodoulou J., Gooptu B. DIP original experiment: DIP-249291X Structure (London, England : 1993) 2012 IMEx Structural dynamics associated with intermediate formation in an archetypal conformational disease. Structural dynamics associated with intermediate formation in an archetypal conformational disease. Structural dynamics associated with intermediate formation in an archetypal conformational disease. Structure (London, England : 1993) 2012 imex curation Nyon MP., Segu L., Cabrita LD., Lévy GR., Kirkpatrick J., Roussel BD., Patschull AO., Barrett TE., Ekeowa UI., Kerr R., Waudby CA., Kalsheker N., Hill M., Thalassinos K., Lomas DA., Christodoulou J., Gooptu B. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining Nyon MP., Segu L., Cabrita LD., Lévy GR., Kirkpatrick J., Roussel BD., Patschull AO., Barrett TE., Ekeowa UI., Kerr R., Waudby CA., Kalsheker N., Hill M., Thalassinos K., Lomas DA., Christodoulou J., Gooptu B. DIP original experiment: DIP-249290X Structure (London, England : 1993) 2012 IMEx Structural dynamics associated with intermediate formation in an archetypal conformational disease. ctra_bovin Chymotrypsinogen A protein protein bovin Bos taurus (Bovine) Bovine CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN DIP protein P00766 original sequence version: 119 91A9F28E2F3E3142 a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK DIP protein P01009 original sequence version: 186 DIP protein P01009-1 original sequence version: 182 7016555F273B7F16 serpina1-5 2 4 unspecified role unspecified role unspecified role unspecified role Mature protein Region 25-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P01009:p.Lys178Asn K178N mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K N This feature has been corrected as a result of our quality control procedures. The original label was 'K178N'. Wed May 02 18:01:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys178asn' Tue Jun 30 19:09:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys178Asn' ecolx Escherichia coli direct interaction direct interaction ctra_bovin-serpina1-1 1 3 enzyme enzyme unspecified role unspecified role bovin Bos taurus (Bovine) Bovine 4 enzyme target enzyme target substrate substrate unspecified role unspecified role Mature protein Region 25-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli protein cleavage protein cleavage