DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Nature structural & molecular biology 2012 imex curation Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256075X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Nature structural & molecular biology 2012 imex curation Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256077X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Nature structural & molecular biology 2012 imex curation Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256074X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Nature structural & molecular biology 2012 imex curation Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256076X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Nature structural & molecular biology 2012 imex curation Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256078X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. Nature structural & molecular biology 2012 imex curation Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maison C., Romeo K., Bailly D., Dubarry M., Quivy JP., Almouzni G. DIP original experiment: DIP-256079X Nature structural & molecular biology 2012 IMEx The SUMO protease SENP7 is a critical component to ensure HP1 enrichment at pericentric heterochromatin. cbx5_mouse Chromobox protein homolog 5 Cbx5 Hp1a Heterochromatin protein 1 homolog alpha protein protein mouse Mus musculus Mouse MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKESAKS DIP protein Q61686 original sequence version: 105 DIP protein Q61686 original sequence version: 91 DIP protein Q61686 original sequence version: 107 8AB87E2F00DB8C40 cbx3_mouse Chromobox protein homolog 3 Cbx3 Heterochromatin protein 1 homolog gamma Modifier 2 protein M32 protein protein mouse Mus musculus Mouse MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ DIP protein P23198 original sequence version: 123 DIP protein P23198 original sequence version: 121 DIP protein P23198 original sequence version: 111 2FF3AD53B883E27E senp7_mouse Sentrin-specific protease 7 Senp7 Kiaa1707 Susp2 SUMO-1-specific protease 2 Sentrin/SUMO-specific protease SENP7 protein protein mouse Mus musculus Mouse MDRARPGRRRASSEIVTEGKRKKSSPADLQKITKLLTVKSEDVLAQSPLSKLRGSECWWTRSLRNKVICLDHKKPKAARGCPPKGLPKRHLRVMLTNVLWTDLGREFRKTLPRKDANLCAPSKVQSDSLPSTSVDSIETCQRLDPLHQSLNLSERTPRVILTDIRQTELGRKYLKIPPVTEASLSDTANLKSEQLSSSSDGSLESCQSVNHHKSFLSESGPKPSRTGDVPAKEAACGGQKQGDDGGVTPEMAAPHPKDFNTGNKGCDYLEEGTSNKNTSYSYSEMDHTPVSRKRKKRGRSNFHDSHNSKTSLDKPTEHTKEEENDSSVSRKLEESGEDSHQDPAPPEGLAPESLESEATNLRSFAAGQEPDASAASGRASSPNKSLESSASSEVSENSSVAVKGEALTLKEASPPGGSSEESQLLISAEPIVVSSDEEGPVEHKNSVILKLQPPHEIMSENQGTSDPQLSELTLGACESVQVTSELFPYNPDVENISCIKSNSEMDLKLDFIFTCVYIGKIKGTPKGCVTFTKKYIKIPFQVSTNEISLTVDTARLKRFGLWESKDEDHSKRSHAILFLWLSSDYLQDIQTQLENPMLSQQSKANEFIFLELNSSISQREELKLKDIMMEISTKNGNLHLSCPLPWVQALPLFQDLSPQEISFLHYYYASASALPTAAGADMKKKSVSQPSNSDTIKPTYTFLHKQSSGCYSLSITSSPEEEWQEVRNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAEDSQSTEVNMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHREFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFELPIHLEKWFPRHVIKTKREDIRELILKLHLQQQKGGSC DIP protein Q8BUH8 original sequence version: 69 cbx1_mouse Chromobox protein homolog 1 Cbx1 Cbx Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 protein protein mouse Mus musculus Mouse MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN DIP protein P83917 original sequence version: 93 BE687AF9C66E48E3 sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 sumo3_human Small ubiquitin-related modifier 3 SMT3 homolog 1 SUMO-2 SMT3H1 SUMO3 SMT3A Ubiquitin-like protein SMT3A protein protein human Homo sapiens Human MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF DIP protein P55854 original sequence version: 56 DIP protein P55854 original sequence version: 127 DIP protein P55854 original sequence version: 106 DIP protein P55854 original sequence version: 124 DIP protein P55854 original sequence version: 99 E337E34CB5B3B187 senp7-cbx5-1 3 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse physical association physical association cbx5-sumo3-1 5 12 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse physical association physical association senp7-cbx5-2 4 7 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction senp7-cbx1-1 1 8 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse 9 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association cbx5-senp7-1 6 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse physical association physical association cbx5-sumo1-1 2 11 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse Mus musculus Mouse physical association physical association