DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. DIP original experiment: DIP-251541X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. DIP original experiment: DIP-251543X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. DIP original experiment: DIP-251546X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. DIP original experiment: DIP-251545X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. DIP original experiment: DIP-251542X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. DIP original experiment: DIP-251544X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. Proceedings of the National Academy of Sciences of the United States of America 2012 imex curation Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baranek C., Dittrich M., Parthasarathy S., Bonnon CG., Britanova O., Lanshakov D., Boukhtouche F., Sommer JE., Colmenares C., Tarabykin V., Atanasoski S. DIP original experiment: DIP-251540X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Protooncogene Ski cooperates with the chromatin-remodeling factor Satb2 in specifying callosal neurons. mta2_mouse Metastasis-associated protein MTA2 Mta2 Mta1l1 Metastasis-associated 1-like 1 protein protein mouse Mus musculus Mouse MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILNQYLDKEDCFFYSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLTQNRGLGGIMVKRSYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLMTVRPPVPLPASSHPASTNEPIVLED DIP protein Q9R190 original sequence version: 108 DIP protein Q9R190 original sequence version: 99 DIP protein Q9R190 original sequence version: 119 DIP protein Q9R190 original sequence version: 138 DIP protein Q9R190 original sequence version: 144 DIP protein Q9R190 original sequence version: 111 88996F779BA6F4D1 satb2_mouse DNA-binding protein SATB2 Satb2 Kiaa1034 Special AT-rich sequence-binding protein 2 protein protein mouse Mus musculus Mouse MERRSESPCLRDSPDRRSGSPDVKGPPPVKVARLEQNGSPMGARGRPNGAVAKAVGGLMIPVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETALLALGYSHSSAAQAQGIIKLGRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQLQSCSKLEDLPAEQWNHATVRNALKELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSPQLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFLNHPPIPRAVKPEPTNSSVEVSPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSLLVNLRAMQNFLNLPEVERDRIYQDERERSMNPNVSMVSSASSSPSSSRTPQAKTSTPTTDLPIKVDGANVNITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCTIRRFLNLPQHERDVIYEEESRHHHSERMQHVVQLPPEPVQVLHRQQSQPTKESSPPREEAPPPPPPTEDSCAKKPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAETDQR DIP protein Q8VI24 original sequence version: 90 153CFD1CC3491F25 hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 ski_human Ski oncogene SKI Proto-oncogene c-Ski protein protein human Homo sapiens Human MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAVPAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVALAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGRLRAKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGSEGAAELEP DIP protein P12755 original sequence version: 126 DIP protein P12755 original sequence version: 130 9B78C4840A28C2DA ski_mouse Ski oncogene Ski Proto-oncogene c-Ski protein protein mouse Mus musculus Mouse MEAAAAGRGGFQQPGLQKTLEQFHLSSMSSLGGPAVSRRAGQEAYKKESAKEAGAATVPAPVPTAAEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYANKYKRRVPRVSEPPASIRPKTDDTSSQSPASSEKDKQSTWLRTLAGSSNKSLGCTHPRQRLSAFRPWSPAVSASEKETSPHLPALIRDSFYSYKSFETAVAPNVALAPPTQQKVVNSPPCTTVVSRAPEPLTTCIQPRKRKLTLDTAGAPDMLTPVAAAEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLSSPGMHAPPVVAPDAAAHVDAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLTAALQAKRTLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAENEKKMKEANESRVRLKRELEQARQVRVCDKGCEAGRLRAKYSAQVEDLQAKLQHAEADREQLRADLLREREAREHLEKVVRELQEQLRPRPRPEHPGGESNAELGP DIP protein Q60698 original sequence version: 91 ski-satb2-1 7 9 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association hdac1-satb2-1 2 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association satb2-ski-1 3 12 unspecified role unspecified role prey prey human Homo sapiens Human 9 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association satb2-ski-2 1 9 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association mta2-satb2-1 6 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association ski-satb2-2 5 9 unspecified role unspecified role prey prey mouse Mus musculus Mouse 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association ski-satb2-3 4 12 unspecified role unspecified role bait bait human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association