DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220236X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220231X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220235X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220234X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220237X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220232X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220233X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS biology 2011 imex curation Baker MD., Neiditch MB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Baker MD., Neiditch MB. DIP original experiment: DIP-220230X PLoS biology 2011 IMEx Structural basis of response regulator inhibition by a bacterial anti-activator protein. cmpa_bacsu Transcriptional regulatory protein ComA comA Competence protein A comA1 comAA BSU31680 protein protein bacsu Bacillus subtilis MKKILVIDDHPAVMEGTKTILETDSNLSVDCLSPEPSEQFIKQHDFSSYDLILMDLNLGGEVNGMELSKQILQENPHCKIIVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHVLNGEILVDFAYFKQLMTQQKTKPAPSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL 52D01A9740759072 52D01A9740759072 phrf_bacsu Phosphatase RapF inhibitor phrF Phosphatase regulator F ywhI BSU37470 protein protein bacsu Bacillus subtilis MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI 1B3BACD457109DF1 rapf_bacsu Response regulator aspartate phosphatase F rapF ywhJ BSU37460 protein protein bacsu Bacillus subtilis MTGVISSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGVSLYEIEV 6F1C0BF6232E739F phrf-rapf-1 5 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction coma-rapf-1 4 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction coma-rapf-2 8 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role DNA-binding domain Region 146-214 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction coma-rapf-3 6 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role P14204:p.Arg183Ala R183A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R183A'. Wed May 02 16:01:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg183ala' Tue Jun 30 18:53:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg183Ala' P14204:p.Tyr187Ala Y187A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y187A'. Wed May 02 14:30:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr187ala' Tue Jun 30 17:39:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr187Ala' P14204:p.Thr190Ala T190A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A This feature has been corrected as a result of our quality control procedures. The original label was 'T190A'. Wed May 02 15:29:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr190ala' Tue Jun 30 17:04:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr190Ala' P14204:p.Asn194Ala N194A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N194A'. Wed May 02 15:15:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn194ala' Tue Jun 30 18:19:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn194Ala' ecolx Escherichia coli direct interaction direct interaction coma-rapf-4 2 11 unspecified role unspecified role unspecified role unspecified role P71002:p.Asp28Ala D28A mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D28A'. Wed May 02 16:20:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp28ala' Tue Jun 30 19:55:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp28Ala' P71002:p.Leu67Ala L67A mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L67A'. Wed May 02 17:23:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu67ala' Tue Jun 30 15:50:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu67Ala' P71002:p.Pro27Ala P27A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A This feature has been corrected as a result of our quality control procedures. The original label was 'P27A'. Wed May 02 17:31:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro27ala' Tue Jun 30 15:39:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro27Ala' P71002:p.Gln78Ala Q78A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Q A This feature has been corrected as a result of our quality control procedures. The original label was 'Q78A'. Wed May 02 16:11:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln78ala' Tue Jun 30 16:55:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln78Ala' P71002:p.Phe24Ala F24A mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F24A'. Wed May 02 16:04:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe24ala' Tue Jun 30 17:01:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe24Ala' ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction coma-1 3 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction coma-rapf-5 7 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction phrf-rapf-2 1 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction