DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Cho US., Harrison SC. DIP original experiment: DIP-248990X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho US., Harrison SC. DIP original experiment: DIP-248994X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Cho US., Harrison SC. DIP original experiment: DIP-248987X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Cho US., Harrison SC. DIP original experiment: DIP-248991X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho US., Harrison SC. DIP original experiment: DIP-248996X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho US., Harrison SC. DIP original experiment: DIP-248992X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Cho US., Harrison SC. DIP original experiment: DIP-248989X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Cho US., Harrison SC. DIP original experiment: DIP-248995X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Cho US., Harrison SC. DIP original experiment: DIP-248993X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Ndc10 is a platform for inner kinetochore assembly in budding yeast. Nature structural & molecular biology 2011 imex curation Cho US., Harrison SC. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cho US., Harrison SC. DIP original experiment: DIP-248988X Nature structural & molecular biology 2011 IMEx Ndc10 is a platform for inner kinetochore assembly in budding yeast. o94228_klulc E3 ubiquitin ligase complex SCF subunit SKP1 KDRO_E03850 protein protein klulc Kluyveromyces lactis (Yeast) Yeast Candida sphaerica MSKENQNVVLVSVEGERFVVDRKIAERSLLLKNYLQDLNSGDLHDDNDADDDEDDEEDGDDEIVMPVPNVRSSVLQKVIEWAVHHKDSNFPDEDDDDSRKAAPVDPWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRTPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR DIP protein O94228 original sequence version: 62 q6ck37_klula KLLA0_F13816g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MFDTKLFLSLPIDIRYTVYFFLGDVVQNVRPPAKSDIFNDELIAYPNIREFNQSLVDKYSKHIGVYDYIPNFIPNWCRDFDLLRHDIILTDRLRVCLQYEEQWFSVQWIVVSGELEIGIFTTDEQFLQVSYTINEYCHLLSIAQQDLRLGINVSDINDVNELCKEIQHRWLFDTVSYISFINCWDLDHENVVSIIPCMESFNNLHMLRIESKNMFNNLINTQGVRENPGKTIVYNVRQNIFELELYTLRDLGYKSVVDLQKWEQLQCLSLSGCEFIDLNNLILPQHCKMLILKEVKYIIWWDLSHLLKRIRPQWIINGQVKKPTKKEEEEESEWYNLYLEVVQTYQPLNFIELHNAKRVKGNLILPARLVTESRIKISNGTKVDSVLLI DIP protein Q6CK37 original sequence version: 35 q6cpb9_klula KLLA0_E06073g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MNDSNLSSAMDLSFLSEESSLQQIGSLNTPKLPKAEKRKRGRPRTKPVVPVELDANGNPIKKQRGRPRKNPTTEARKSAKKEPILDENGLPVKKRRGRPRKSLIDPTNISFTSESKKNTTTDNNNNIQDTSGGIPKASRAKHSHNVLPIPIQPKKRGRPKKTESIVSVRTEQLHEDMNYSNDMKLKIEKILHKKDNYPNLISSRDTFDPKKSSHRSDVSELESSPVKDNSQRKSIHCASSSIAGVTDSISAYSSKGSTSLSSDDSYKPEVDPLEKVQSDHRADKGRIEFGDNTASDQLQRGTDSAIQTQAPRKRGRPKKLRDETAEPKIKRPRGRPPKDKDNKDKNQSASNTEKLPENQWTLNDIISCRMQQKDQLEASPKKKIKLAKTAAQLGINDSKGSQVGETSFMQSVEKNKDVFLDFKKNKEKATKPNTILDDSYDVFSFDNNGTSNFVIPEEAFPAQSSKKNKTEKSSPMKPLKEQLELIDTDIAFSDESENDSDYSPNDNQDGVHSSPVQSLPDRERDLLRPKQNPIDEPELANDVSRAQNRMEQGADISNELVESHANNLGADNTERRTSNRLSDEWSLSLTFQDVNGQGTPDVSPSNKPKVSFAPFPSSPDVDTKAVINNSNHSTDHPHLDQKYQDAESITQTTPIESLPKWNVLHNSELTSLSEDVLTLNKYFSDLLLYMNRIDASLASDLTGELTFFINSMPNEELALNFKNWIDQKGKEIFESFETTINTKIETLQRQFSTAKEFIQQIDDDSVLLEFANRFNIDF DIP protein Q6CPB9 original sequence version: null cbf1_klula Centromere-binding protein 1 CBF1 CPF1 Centromere promoter factor 1 Centromere-binding factor 1 KLLA0B13761g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSGKRSYQDDQLDVEEANKRHQMVDTLLRGSEDKDGDNDNSVYDDLLQDPEEVEKENKENRDGDKVGDDEHDVVKGESEGQAAEQSSADQNDENINVDVDPSVTAVARAAQHASQRREAGDEDEDEDEEEEEDEDDHVDIDDVDKDPDAVIDEDDDEEDEDQAQRRRGKKNIEGTGESNDSERATKIGESGSSNETAGADGSGDREDGSQPDGTEHDDEENGGAGAGGAAPRRGRKPGTETGSTAWKQQRKESHKEVERRRRQNINTAIEKLSDLLPVKETSKAAILSRAAEYIQKMKETETANIEKWTLQKLLGEQQVSSLTSANDKLEQELSKAYKNLEELKKKLKEAGIEDPTEEE DIP protein P49379 original sequence version: 74 q6crd4_klula KLLA0_D09977g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSKPKISLTKGKHPCTFCQARKVKCDRSLPACQNCIERNVTELCEYDDNGSRKRARLADDVNLYDKKLFNIWNQYERLWIHDTLGQCQQGVYMGIAFPLDVSEYNNTKDFYGYECLFSKESIFKILDHSLERLGWLYFGFFTDISELPYQMERYWNEYESMNINLENEEATTRQTTFKKSADQILWDLVLRSVIVMTIYYMPAKSILSLVDIDAIEKYPLDFSESNEGVDELKKKYEIFDYCLRHTLNKVLRTIFTLPPDVRTLQIFLILSNTNFLQIYPSLGNNILVHCIHLAKVLGIKDFKLKINDSGSTRLQKLSMHNIWFRLSTVDYMRSSPNKIIALHTDNSSALTRKTLFTHCSIDSIDVYDVESNLEVLRWKITSLDRDLEVSEPSLKTLKAMKELLGLLDRKTSVSNDASFNTKFESFFLKLQCNFVMWKILRYEFMQYGVTNGLQKLCCPARRIIALVANFLKEDYFEYTTHPFCVHILCVIAGFFSFYCIFHEADEVRDLRNDAVGLLKLLFDPLRPVISCFFSNLSRLEELRHIWKSVEITDQANRLVHPVMYVLKTDIIKLKRNLEIISGSLKDANYQETFKDKLEIDINTPALSSDFLEVVREFNLSHPLDINGKMSRQNN DIP protein Q6CRD4 original sequence version: 46 q6cpm4_klula KLLA0_E03807g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MSKLDSLLKELPTRTAHLYRSIWHKYTEWLKTMPDLTGADLKLFLSQKYIVKYIASHDDIAKDPLPTCDAMIWFSRALDIENNDVLVLQQRLYGLVKLLEFDYSNVIAILQKISINLWNPSTDSLQSKHFKTCQDKLKLLLDFQWKFNTNVSFEDRTTVSLKDLQCILDDENGKCGLAHSSKPNFVLVPNFQSPFTCPIFTMAVYYYLRFHGVKKYYKGDGYQILSQLEHIPIIRGKSLDQYPRELTLGNWYPTIFKYCQLPYTKKHWFQVNQEWPQFPDFSDSSENTSTLAESDSENTIGIPDFYIEKMNRTKLQPCPQVHVHLFPTDLPPDIQAVFDLLNSVLVTSLPLLYRVFPTHDIFLDPSLKTPQNIAFLTGTLPLDIESQEHLLAQLIDKTGTVSELVPNPVKIDQNEHTLTPIGTSLSQTDIPMLDQLKTELQKLIQLQTSTGFSQLITVLLEIFQRLDFKKSNKQFVIDLLQSCRKDMRNKLMDPCSLSTNFADELSDDENEKGNKTGAIYDPETDNGNEESVSDYEPSFKKSKPNYTEEPLSDDENMEEVAQLVNQLITRKFNENLEQQTDRIISSIQPTLRDMVRTEVADALNLSLREASRDSVNKKNSDENFQNYSLTEDHFEMNPDCSDIKSIILEWFTPNRECVHSMNKKYGNKWRLTEPNLSLYRIRKPIVQYYIHLINVENLNKFDALNKLEAVLEKHHSVPLLSSFLEKAKKNGYASVT DIP protein Q6CPM4 original sequence version: 37 q6cl77_klula KLLA0_F05115g protein protein klula Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) Yeast Candida sphaerica MIKRPSNSKKKANLRRLTGALRDLLGEEEPKKEENLKQITRDGVVYIMSKENRLIPKLSDEEVMERHKKADENMKRVWSQIIQKYESIDNQGDVIDLQTGEVIEDNGHLRNLSNEKSVLHSSLPDGGSVSYKSVLNDIMDIKDSSYNSSVWQDHETNDSETGSESESGLEADGLDEGSGSEADNSNEVYMKKLRPNPESN DIP protein Q6CL77 original sequence version: 44 DIP protein Q6CL77 original sequence version: 40 q6cpm4_klula-1 3 16 unspecified role unspecified role unspecified role unspecified role Region 1-534 Region 1-534 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q6cpm4_klula-q6cpb9_klula-1 4 13 unspecified role unspecified role prey prey Region 1-328 Region 1-328 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 16 unspecified role unspecified role bait bait Region 1-534 Region 1-534 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction q6cpm4_klula-q6cl77_klula-1 8 17 unspecified role unspecified role prey prey Region 1-115 Region 1-115 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 16 unspecified role unspecified role bait bait Region 552-736 Region 552-736 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction q6ck37_klula-q6crd4_klula-1 9 12 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 11 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association q6cl77_klula-q6cpm4_klula-1 5 17 unspecified role unspecified role bait bait Region 1-40 Region 1-40 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey Region 552-736 Region 552-736 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q6crd4_klula-q6cpm4_klula-1 10 15 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 16 unspecified role unspecified role prey prey Region 1-100 Region 1-100 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction q6cpm4_klula-cbf1-1 1 14 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 229-359 Region 229-359 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cbf1-q6ck37_klula-1 6 12 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 15 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 14 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association q6cl77_klula-q6cpm4_klula-2 2 17 unspecified role unspecified role unspecified role unspecified role Region 1-115 Region 1-115 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role Region 552-736 Region 552-736 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction q6cpm4_klula-cbf1-2 7 14 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 16 unspecified role unspecified role bait bait Region 1-403 Region 1-403 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction