DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The fifth adaptor protein complex. The fifth adaptor protein complex. PLoS biology 2011 imex curation Hirst J., Barlow LD., Francisco GC., Sahlender DA., Seaman MN., Dacks JB., Robinson MS. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hirst J., Barlow LD., Francisco GC., Sahlender DA., Seaman MN., Dacks JB., Robinson MS. DIP original experiment: DIP-252475X PLoS biology 2011 IMEx The fifth adaptor protein complex. The fifth adaptor protein complex. The fifth adaptor protein complex. PLoS biology 2011 imex curation Hirst J., Barlow LD., Francisco GC., Sahlender DA., Seaman MN., Dacks JB., Robinson MS. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hirst J., Barlow LD., Francisco GC., Sahlender DA., Seaman MN., Dacks JB., Robinson MS. DIP original experiment: DIP-252477X PLoS biology 2011 IMEx The fifth adaptor protein complex. The fifth adaptor protein complex. The fifth adaptor protein complex. PLoS biology 2011 imex curation Hirst J., Barlow LD., Francisco GC., Sahlender DA., Seaman MN., Dacks JB., Robinson MS. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hirst J., Barlow LD., Francisco GC., Sahlender DA., Seaman MN., Dacks JB., Robinson MS. DIP original experiment: DIP-252476X PLoS biology 2011 IMEx The fifth adaptor protein complex. q9h0r1-1 AP-5 complex subunit mu-1 AP5M1 C14orf108 MUDENG Adaptor-related protein complex 5 subunit mu-1 Mu-2-related death-inducing protein Putative HIV-1 infection-related protein protein protein human Homo sapiens Human MAQRAVWLISHEPGTPLCGTVRFSRRYPTVEKRARVFNGASYVPVPEDGPFLKALLFELRLLDDDKDFVESRDSCSRINKTSIYGLLIGGEELWPVVAFLKNDMIYACVPLVEQTLSPRPPLISVSGVSQGFEFLFGIQDFLYSGQKNDSELNTKLSQLPDLLLQACPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPTNGSPLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITINLKLHESVKNNFEFCEAHIPFYNRGPITHLEYKTSFGQLEVFREKSLLIWIIGQKFPKSMEISLSGTVTFGAKSHEKQPFDPICTGETAYLKLHFRILDYTLTGCYADQHSVQVFASGKPKISAHRKLISSDYYIWNSKAPAPVTYGSLLL DIP protein Q9H0R1-1 original sequence version: 77 ap5m1_human AP-5 complex subunit mu-1 AP5M1 C14orf108 MUDENG Mu-2-related death-inducing protein Putative HIV-1 infection-related protein Adaptor-related protein complex 5 subunit mu-1 protein protein human Homo sapiens Human MAQRAVWLISHEPGTPLCGTVRFSRRYPTVEKRARVFNGASYVPVPEDGPFLKALLFELRLLDDDKDFVESRDSCSRINKTSIYGLLIGGEELWPVVAFLKNDMIYACVPLVEQTLSPRPPLISVSGVSQGFEFLFGIQDFLYSGQKNDSELNTKLSQLPDLLLQACPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPTNGSPLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITINLKLHESVKNNFEFCEAHIPFYNRGPITHLEYKTSFGQLEVFREKSLLIWIIGQKFPKSMEISLSGTVTFGAKSHEKQPFDPICTGETAYLKLHFRILDYTLTGCYADQHSVQVFASGKPKISAHRKLISSDYYIWNSKAPAPVTYGSLLL DIP protein Q9H0R1 original sequence version: 77 F8B2FE622A2B8BD9 ap5s1_human AP-5 complex subunit sigma-1 AP5S1 C20orf29 Adaptor-related protein complex 5 sigma subunit protein protein human Homo sapiens Human MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQVESMCRLQQQASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSLGFALVLDAHENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAWPR DIP protein Q9NUS5 original sequence version: 62 B007496045724E34 ap5b1_human AP-5 complex subunit beta-1 AP5B1 Adaptor-related protein complex 5 beta subunit PP1030 protein protein human Homo sapiens Human MGPLSRDAWAQRLGAFRASPSAFMAGPEGEDLGRDLLSDLRSEKLSEQTKVSLLALSMEYPAQLWPDASAAEVAATSLLDTLVLLPPRPSALRRPLLLAATTALAAGGALGPTSGASCRLLPLLLGLAAGSDLGRGFVPASEQRPLQATACECLRELESCKPGLLGGSLGLLRGLLGQEGPVQPLSLLLALALRNTLVLQSRVGAGLGGLLTDKVSPTGGGPWDWTLVEEGDGRLQPQAPSWPAAEEGEGERSLTAREHSPEEARELRAAVIQLLDTSYLLTPVAQAQLLWLLGWALRGLQGQPPALFKPQLVRLLGTAQLTLLHAMLALKAAFGEALFTAQDEALLLRRLTLAAQHPALPPPTHLFYLHCVLSFPENWPLGPEGEEAAPLLLGPQLCRGLLPSLLHDPMALLARLHLLCLLCAEEEEEEKGQLPSPRHYLEELLAGLRQRAALDGGPRALATLCFQASYLVACCLAGQPTVLTPLIHGLAQLYQARPMLAPHFVDLLDQVDSELREPLKVVLRQVVVSRPGRDEALCWHLQMLAKVADGDAQSATLNFLQAAAAHCTNWDLQQGLLRVCRALLRAGVRGGLVDLLQVLARQLEDPDGRDHARLYYILLAHLAAPKLGVALGPSLAAPALASSLVAENQGFVAALMVQEAPALVRLSLGSHRVKGPLPVLKLQPEALEPIYSLELRFRVEGQLYAPLEAVHVPCLCPGRPARPLLLPLQPRCPAPARLDVHALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLGFFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHLPPDSKLLLRLEAALADGVPVALRTDDWAVLPLAGDYLRGLAAAV DIP protein Q2VPB7 original sequence version: 36 B1E8A2BBFE45872B ap5m1-ap5b1-1 1 7 unspecified role unspecified role prey prey Region 16-229 Region 16-229 binding region binding-associated region binding region full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ap5m1-ap5b1-2 3 7 unspecified role unspecified role prey prey Region 16-229 Region 16-229 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction ap5s1-ap5b1-1 2 5 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human Homo sapiens Human association association