DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing. Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Johnston CA., Whitney DS., Volkman BF., Doe CQ., Prehoda KE. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Johnston CA., Whitney DS., Volkman BF., Doe CQ., Prehoda KE. DIP original experiment: DIP-250170X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing. q9vb22_drome pins raps Dmel\CG5692 PINS Pins Rad Raps rad rapsyn Dmel_CG5692 CG5692 RAPS dLGN dPins protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSLSASAENVSSLGLGSGGGGTTSHDGNSQQGSGSDGGSSMCLELALEGERLCKAGDCRAGVAFFQAAIQAGTEDLRTLSAIYSQLGNAYFYLGDYNKAMQYHKHDLTLAKSMNDRLGEAKSSGNLGNTLKVMGRFDEAAICCERHLTLARQLGDRLSEGRALYNLGNVYHAKGKHLGQRNPGKFGDDVKEALTRAVEFYQENLKLMRDLGDRGAQGRACGNLGNTYYLLGDFQAAIEHHQERLRIAREFGDRAAERRANSNLGNSHIFLGQFEDAAEHYKRTLALAVELGEREVEAQSCYSLGNTYTLLHEFNTAIEYHNRHLAIAQELGDRIGEARACWSLGNAHSAIGGHERALKYAEQHLQLAKELHDPVGESTARVNISDLRKLLGMPDSEPSPTEEEARSTASDHSASGNQSDGSENSQGRMVRVRRQSMEQLDLIKITPDGKRMQEEKLRAQATRKAKDDDFFEMLSRSQSKRMDDQRCSIKVNPAGAPAVATGATRKPLVQQNSLFVDPTNLPGLKSPSSANPSAIGHGPLARSATTTQQPDDDFLDMLMRCQGSRLEEQRSELPRPNVTMDAEAEAPPRSVPEAAVPGAPRGQTGRGATVPDEDFFSLIMKVQSGRMEDQRASIPFRNANNNNNSRSNNNGSAGGAGK DIP protein Q9VB22 original sequence version: 131 DIP protein Q9VB22 original sequence version: 109 DIP protein Q9VB22 original sequence version: 126 5D24B15B4FAE584F kgua_yeast Guanylate kinase GUK1 YDR454C D9461.39 GMP kinase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDFIFAEK 5DC4D2A22594BFB8 5DC4D2A22594BFB8 pins-scgk-1 1 2 unspecified role unspecified role bait bait LINKER domain Region 399-466 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 3 unspecified role unspecified role prey prey P15454:p.Ser35Pro S35P mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S P This feature has been corrected as a result of our quality control procedures. The original label was 'S35P'. Wed May 02 16:07:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser35pro' Tue Jun 30 20:10:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser35Pro' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction