HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The type III system-secreted effector EspZ localizes to host mitochondria and interacts with the translocase of inner mitochondrial membrane 17b. The type III system-secreted effector EspZ localizes to host mitochondria and interacts with the translocase of inner mitochondrial membrane 17b. Infection and immunity 2011 imex curation Shames SR., Croxen MA., Deng W., Finlay BB. bfinlay@interchange.ubc.ca 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shames SR., Croxen MA., Deng W., Finlay BB. bfinlay@interchange.ubc.ca Accepted 2017-APR-10 AT 14:29 BST AT 14:29 BST by MGT Infection and immunity 2011 imex curation ti17b_human Mitochondrial import inner membrane translocase subunit Tim17-B TIMM17B TIM17B JM3 protein protein human Homo sapiens Human MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH 5DF3926F815E835A q7db68_eco57 ECs_4571 E5F08_27455 espZ protein protein eco57 Escherichia coli O157:H7 MEAANLSPSGAVMPLATSLSGNNSVDEKTGVIKPENGTNRTVRVIAGLALTTTALAALGTGIAAACSETSSTEYLALGITSGVLGTLTAVGGALAMKYA 7CDD4A41B0E0E7E0 espz-tim17b-1 1 2 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role prey prey c terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3