DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218683X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218691X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218686X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218688X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218682X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218687X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218684X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218685X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218690X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218689X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218693X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. Nature structural & molecular biology 2011 imex curation Yoon SI., Hong M., Wilson IA. Only protein-protein interactions spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm pull down pull down predetermined predetermined participant predetermined Yoon SI., Hong M., Wilson IA. DIP original experiment: DIP-218692X Nature structural & molecular biology 2011 IMEx An unusual dimeric structure and assembly for TLR4 regulator RP105-MD-1. ly86_human Lymphocyte antigen 86 LY86 MD1 Protein MD-1 protein protein human Homo sapiens Human MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS DIP protein O95711 original sequence version: 88 DIP protein O95711 original sequence version: 81 3E6497E2DB4C6F27 ly86_mouse Lymphocyte antigen 86 Ly86 Md1 Protein MD-1 protein protein mouse Mus musculus Mouse MNGVAAALLVWILTSPSSSDHGSENGWPKHTACNSGGLEVVYQSCDPLQDFGLSIDQCSKQIQSNLNIRFGIILRQDIRKLFLDITLMAKGSSILNYSYPLCEEDQPKFSFCGRRKGEQIYYAGPVNNPGLDVPQGEYQLLLELYNENRATVACANATVTSS DIP protein O88188 original sequence version: 78 EED25DEA64A9372E tlr4_mouse Toll-like receptor 4 Tlr4 Lps protein protein mouse Mus musculus Mouse MMPPWLLARTLIMALFFSCLTPGSLNPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSLRHLDLSFNGAIIMSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTLHRLQLLNMSHNNLLFLDSSHYNQLYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVACICEHQKFLQWVKEQKQFLVNVEQMTCATPVEMNTSLVLDFNNSTCYMYKTIISVSVVSVIVVSTVAFLIYHFYFHLILIAGCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFHLCLHYRDFIPGVAIAANIIQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQVELYRLLSRNTYLEWEDNPLGRHIFWRRLKNALLDGKASNPEQTAEEEQETATWT DIP protein Q9QUK6 original sequence version: 103 DIP protein Q9QUK6 original sequence version: 118 DIP protein Q9QUK6 original sequence version: 71 9C83B59F9A220C17 ly96_mouse Lymphocyte antigen 96 Protein MD-2 ESOP-1 Ly96 Esop1 Md2 protein protein mouse Mus musculus Mouse MLPFILFSTLLSPILTESEKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN DIP protein Q9JHF9 original sequence version: 80 DIP protein Q9JHF9 original sequence version: 91 E224D17E5D5429E2 q0v8g5_bovin CD180 protein protein bovin Bos taurus (Bovine) Bovine MAPCVSCFLLAVLISAGCKAIPSSDPKCTEKEGNRTYNCENLGLREIPDTLPNTTEVLEFSFNFLPTIQNTTFSRLINLIFLDLTRCQINWVHEDTFQSHHQLNTIVLTGNPLIFMAETSLTGPKFLKHLFLTQTGISNLKFIPVHNLENLESLHLGSNHISSINLPENFPTQNLKVLDFQNNAIHYISRKDTNSLEQATNLSLNFNGNDIKGIEPGAFSSKIFQSLKFGGSLNLFIIFKGLQNSTLQSLWLGTFEDTDDQYLTSATFEGLCDMSVESINLQKHRFSDLSSSTFQCFTRVQELDLTAAHLNGLPSGIEGMNSLKKLVLNANSFDQLCQINAASFPSLRDLYIKGNMRKLDLGTRCLEKLENLQKLDLSHSDIEASDCCNLQLKNLRHLQYLNLSYNEPLGLEDQAFKECPQLELLDVAFTHLHVKAPHSPFQNLHLLRVLNLSHCLLDTSNQHLLAGLQDLRHLNLQGNSFQDGSISKTNLLQMVGSLEILILSSCNLLSIDQQAFHGLRNVNHLDLSHNSLTGDSMDTLSHLKGLYLNMASNNIRIIPPHLLPALSQQSIINLSNNPLDCTCSNIHFITWYKENLHKLEDSEETTCANPPSLRGVKLSDVKLHCGITGVGIFFIVVFVFLLILLLIFSVKFILRWKYQHI DIP protein Q0V8G5 original sequence version: 32 a4ift3_bovin LY86 protein protein bovin Bos taurus (Bovine) Bovine MKGFAAALLIWTLLSPRRAGGEAWPTHTACRNGNLQVLYQSCDPLQDFGFSVDQCARQLKPNINIRFGMVLREDIEQLFLDVALFSKGLSILNFSYPVCEVDLPKFSFCGRRKGEQIYYAGPINNPGFEIPEGDYQVLLELYNQDHATVACANATVLYS DIP protein A4IFT3 original sequence version: 25 cd180_human CD180 antigen CD180 LY64 RP105 Lymphocyte antigen 64 Radioprotective 105 kDa protein protein protein human Homo sapiens Human MAFDVSCFFWVVLFSAGCKVITSWDQMCIEKEANKTYNCENLGLSEIPDTLPNTTEFLEFSFNFLPTIHNRTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETSLNGPKSLKHLFLIQTGISNLEFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTIFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIRGNVKKLHLGVGCLEKLGNLQTLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECPQLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNHFQDGTITKTNLLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIYLNLAANSINIISPRLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLEGSEETTCANPPSLRGVKLSDVKLSCGITAIGIFFLIVFLLLLAILLFFAVKYLLRWKYQHI DIP protein Q99467 original sequence version: 98 cd180_mouse CD180 antigen Cd180 Rp105 Ly78 Lymphocyte antigen 78 Radioprotective 105 kDa protein protein protein mouse Mus musculus Mouse MAPDISCFFLVALFLASCRATTSSDQKCIEKEVNKTYNCENLGLNEIPGTLPNSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLVLTANPLIFMAETALSGPKALKHLFFIQTGISSIDFIPLHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQNNAIHYLSKEDMSSLQQATNLSLNLNGNDIAGIELGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEMSVESINLQKHYFFNISSNTFHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISASNFPSLTHLSIKGNTKRLELGTGCLENLENLRELDLSHDDIETSDCCNLQLRNLSHLQSLNLSYNEPLSLKTEAFKECPQLELLDLAFTRLKVKDAQSPFQNLHLLKVLNLSHSLLDISSEQLFDGLPALQHLNLQGNHFPKGNIQKTNSLQTLGRLEILVLSFCDLSSIDQHAFTSLKMMNHVDLSHNRLTSSSIEALSHLKGIYLNLASNRISIILPSLLPILSQQRTINLRQNPLDCTCSNIYFLEWYKENMQKLEDTEDTLCENPPLLRGVRLSDVTLSCSMAAVGIFFLIVFLLVFAILLIFAVKYFLRWKYQHI DIP protein Q62192 original sequence version: 87 12F91AAB4224602E cd180-ly86-1 7 14 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 20 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction cd180-ly86-2 5 18 unspecified role unspecified role unspecified role unspecified role Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction cd180-ly86-3 6 14 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ly86-cd180-1 10 14 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role prey prey Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association cd180-ly86-4 12 13 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role bait bait Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association cd180-ly86-5 1 18 unspecified role unspecified role unspecified role unspecified role Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction cd180-ly86-6 8 13 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction ly86-cd180-2 11 13 unspecified role unspecified role bait bait StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 19 unspecified role unspecified role prey prey Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association cd180-ly86-7 9 18 unspecified role unspecified role prey prey Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role bait bait Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association ly86-cd180-3 2 18 unspecified role unspecified role bait bait Region 22-159 Region 22-159 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 17 unspecified role unspecified role prey prey Ectodomain Region 24-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association ly96-tlr4-10 3 16 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 26-638 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction cd180-ly86-8 4 14 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 20 unspecified role unspecified role bait bait Ectodomain Region 21-626 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association