DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253907X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253903X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253905X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253906X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253902X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ropars V., Drevet P., Legrand P., Baconnais S., Amram J., Faure G., Márquez JA., Piétrement O., Guerois R., Callebaut I., Le Cam E., Revy P., de Villartay JP., Charbonnier JB. DIP original experiment: DIP-253904X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Structural characterization of filaments formed by human Xrcc4-Cernunnos/XLF complex involved in nonhomologous DNA end-joining. xrcc4_human DNA repair protein XRCC4 X-ray repair cross-complementing protein 4 XRCC4 protein protein human Homo sapiens Human MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIKQEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNLGTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI DIP protein Q13426 original sequence version: 140 DIP protein Q13426-1 original sequence version: 116 BE5FB99153479A4E q9h9q4-1 Non-homologous end-joining factor 1 NHEJ1 XLF Protein cernunnos XRCC4-like factor protein protein human Homo sapiens Human MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS DIP protein Q9H9Q4-1 original sequence version: 69 DIP protein Q9H9Q4-1 original sequence version: 86 DIP protein Q9H9Q4-1 original sequence version: 84 nhej1-xrcc4-6 5 8 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nhej1-xrcc4-7 3 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction xrcc4-5 4 7 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nhej1-xrcc4-8 2 8 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q13426:p.Glu55Arg E55R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E55R'. Wed May 02 14:46:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu55arg' Tue Jun 30 18:49:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu55Arg' Q13426:p.Asp58Arg D58R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D58R'. Wed May 02 14:41:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp58arg' Tue Jun 30 18:13:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp58Arg' Q13426:p.Met61Arg M61R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M R This feature has been corrected as a result of our quality control procedures. The original label was 'M61R'. Wed May 02 20:09:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met61arg' Tue Jun 30 18:47:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met61Arg' Q13426:p.Phe106Glu F106E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F E This feature has been corrected as a result of our quality control procedures. The original label was 'F106E'. Wed May 02 14:27:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe106glu' Tue Jun 30 18:16:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe106Glu' Q13426:p.Lys65Glu K65E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K65E'. Wed May 02 17:53:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys65glu' Tue Jun 30 19:20:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys65Glu' Q13426:p.Phe106Tyr F106Y mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain F Y This feature has been corrected as a result of our quality control procedures. The original label was 'F106Y'. Wed May 02 14:42:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe106tyr' Tue Jun 30 20:19:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe106Tyr' Q13426:p.Phe106Ala F106A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F106A'. Wed May 02 20:29:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe106ala' Tue Jun 30 19:01:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe106Ala' ecolx Escherichia coli direct interaction direct interaction nhej1-xrcc4-9 6 8 unspecified role unspecified role unspecified role unspecified role Region 1-224 Region 1-224 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 1-157 Region 1-157 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction nhej1-1 1 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction