IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. Nature 2011 imex curation Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu Accepted 2017-OCT-05 AT 15:42 BST AT 15:42 BST by ORCHARD Nature 2011 Only protein-protein interactions imex curation imex curation The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. Nature 2011 imex curation Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu Accepted 2017-OCT-05 AT 15:42 BST AT 15:42 BST by ORCHARD Nature 2011 Only protein-protein interactions imex curation imex curation The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. Nature 2011 imex curation Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation arath-seedling Arabidopsis thaliana seedling ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu Accepted 2017-OCT-05 AT 15:42 BST AT 15:42 BST by ORCHARD Nature 2011 Only protein-protein interactions imex curation imex curation The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. Nature 2011 imex curation Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 1 hybrid one hybrid yeast one-hybrid yeast one hybrid one-hybrid 1 hybrid yeast one-hybrid one-hybrid yeast one hybrid predetermined predetermined participant predetermined Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu Accepted 2017-OCT-05 AT 15:42 BST AT 15:42 BST by ORCHARD Nature 2011 Only protein-protein interactions imex curation imex curation The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. The ELF4-ELF3-LUX complex links the circadian clock to diurnal control of hypocotyl growth. Nature 2011 imex curation Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu 15-Nov-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation arath-seedling Arabidopsis thaliana seedling anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA., Nusinow DA., Helfer A., Hamilton EE., King JJ., Imaizumi T., Schultz TF., Farré EM., Kay SA. The elf3-1 mutation has a premature stop codon resulting in a null allele of ELF3. (pmid:PMID: 10759510 ) still on Lucasz's reserve list (in perpetuum?) skay@ucsd.edu Accepted 2017-OCT-05 AT 15:42 BST AT 15:42 BST by ORCHARD Nature 2011 Only protein-protein interactions imex curation imex curation pcll_arath Transcription factor BOA BOA PCLL Protein BROTHER OF LUX ARRHYTHMO Protein PHYTOCLOCK 1-like F2O15.230 At5g59570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGKEVMVSDYGDDDGEDAGGGDEYRIPEWEIGLPNGDDLTPLSQYLVPSILALAFSMIPERSRTIHDVNRASQITLSSLRSSTNASSVMEEVVDRVESSVPGSDPKKQKKSDGGEAAAVEDSTAEEGDSGPEDASGKTSKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLKRIQGLTTEEDPYSSSDQLFSSTPVPPQSFQDGGGSNGKLGVPVPVPSMVPIPGYGNQMGMQGYYQQYSNHGNESNQYMMQQNKFGTMVTYPSVGGGDVNDK 5F1315182637F9F7 pcl1_arath Transcription factor LUX LUX PCL1 Protein LUX ARRHYTHMO Protein PHYTOCLOCK 1 F12A12.160 At3g46640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGEEVQMSDYDVSGDGDRVSEWEMGLPSDEDLASLSYSLIPPNLAMAFSITPERSRTIQDVNRASETTLSSLRGGSSGPNTSSSNNNVEEEDRVGSSSPGSDSKKQKTSNGDGDDGGGVDPDSAMAAEEGDSGTEDLSGKTLKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLKRMQGLTNEGPSASDKLFSSTPVPPQSFQDIGGGGGSSGNVGVPIPGAYGTQQMMQMPVYAHHMGMQGYHHQNHNHDPYHQNHRHHHGAGGNGAFESNPYMMQQNKFGSMASYPSVGGGSANEN A4CF9244F858CE9F elf3_arath Protein EARLY FLOWERING 3 Nematode-responsive protein ELF3 PYK20 F17H15.25 T19L18.26 At2g25930 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKRGKDEEKILEPMFPRLHVNDADKGGPRAPPRNKMALYEQLSIPSQRFGDHGTMNSRSNNTSTLVHPGPSSQPCGVERNLSVQHLDSSAANQATEKFVSQMSFMENVRSSAQHDQRKMVREEEDFAVPVYINSRRSQSHGRTKSGIEKEKHTPMVAPSSHHSIRFQEVNQTGSKQNVCLATCSKPEVRDQVKANARSGGFVISLDVSVTEEIDLEKSASSHDRVNDYNASLRQESRNRLYRDGGKTRLKDTDNGAESHLATENHSQEGHGSPEDIDNDREYSKSRACASLQQINEEASDDVSDDSMVDSISSIDVSPDDVVGILGQKRFWRARKAIANQQRVFAVQLFELHRLIKVQKLIAASPDLLLDEISFLGKVSAKSYPVKKLLPSEFLVKPPLPHVVVKQRGDSEKTDQHKMESSAENVVGRLSNQGHHQQSNYMPFANNPPASPAPNGYCFPPQPPPSGNHQQWLIPVMSPSEGLIYKPHPGMAHTGHYGGYYGHYMPTPMVMPQYHPGMGFPPPGNGYFPPYGMMPTIMNPYCSSQQQQQQQPNEQMNQFGHPGNLQNTQQQQQRSDNEPAPQQQQQPTKSYPRARKSRQGSTGSSPSGPQGISGSKSFRPFAAVDEDSNINNAPEQTMTTTTTTTRTTVTQTTRDGGGVTRVIKVVPHNAKLASENAARIFQSIQEERKRYDSSKP 607A0720ED381C08 elf4_arath Protein EARLY FLOWERING 4 Protein ARRHYTHMIC 44 T28M21.24 At2g40080 ELF4 ARR08 ARR16 ARR19 ARR44 ARR80 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKRNGETKRRRNVAEEAEQGEDPAMWENLDRNFRQVQSVLDRNRSLIQQVNDNHQSRMADNMSKNVALIQELNGNISKVVNMYSDLNTSFSSGFHGGKNGHDGGGAAGTRA 79CBE01F1D410891 pif5_arath_gene gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pif4_arath_gene gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress elf4-elf3-4 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1B lux-elf3-1 1 7 unspecified role unspecified role bait bait c_terminal_region sufficient to bind sufficient binding region sufficient to bind range range c-term range C-terminal range c-term range 8 unspecified role unspecified role prey prey physical association physical association 1C elf4-elf3-2 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role ancillary ancillary n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait physical association physical association 1D elf4-elf3-3 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Figure 2, Supp fig 2F/Fig 6 The presence of ELF3 is necessary for the co-immunoprecipitation of LUX by ELF4–HA. I can see NO interaction between ELF3 and HA-ELF4 - when both are shown to be present in HA IP. pif5_arath_gene-pcl1-1 4 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait promoter_region (-481, +13) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C LUX binding to the PIF5 promoter (from −481 to +13 base pairs) was lost when the consensus LBS was mutated. pif4_arath_gene-pcl1-1 4 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait promoter_region (-474, -1) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C-2 LUX binding to the PIF5 promoter (from −481 to +13 base pairs) was lost when the consensus LBS was mutated. pif4_arath_gene-pcl1-2 3 7 unspecified role unspecified role bait bait c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey promoter_region(-501,+272) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3D elf3-pif4_arath_gene-1 3 8 unspecified role unspecified role bait bait c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey promoter_region (-501,+272) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3E, 3G, supp fig 8/9 ELF3 did not bind when NOX and LUX genes were silenced. elf3-pif4_arath_gene-2 3 9 unspecified role unspecified role bait bait c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey promoter_region (-501,+272) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3F elf4-pif4_arath_gene-1 3 9 unspecified role unspecified role bait bait c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey promoter_region (-481,+13) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3F-2 pcl1-pif4_arath_gene-1 3 7 unspecified role unspecified role bait bait c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey promoter_region (-481,+13) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3D-2 elf3-pif4_arath_gene-3 3 8 unspecified role unspecified role bait bait c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey promoter_region (-481,+13) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3E, 3G, supp fig 8/9 ELF3 did not bind when NOX and LUX genes were silenced. elf4-boa-1 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role ancillary ancillary n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait physical association physical association Supp 10A