DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. DIP original experiment: DIP-249642X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. DIP original experiment: DIP-249641X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. DIP original experiment: DIP-249640X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. DIP original experiment: DIP-249643X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. DIP original experiment: DIP-249639X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Epsin N-terminal homology domains bind on opposite sides of two SNAREs. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wang J., Gossing M., Fang P., Zimmermann J., Li X., von Mollard GF., Niu L., Teng M. DIP original experiment: DIP-249638X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Epsin N-terminal homology domains bind on opposite sides of two SNAREs. vti1_yeast t-SNARE VTI1 VTI1 Qb-SNARE VTI1 Vesicle transport v-SNARE protein VTI1 VPS10-interacting protein 1 YM9646.10C YMR197C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK E55B4DA3B40FAD67 E55B4DA3B40FAD67 ent3_yeast Epsin-3 ENT3 J2048 YJR125C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLEDTLANMSLYDAKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRTRVKALIELLSDDNKIRAERKKARETAKKYKGVAGGSASADGSLNSKAGFTSTKVHGISVSADFDSDNEDNEDGSFSQNGYNDNASRATSTPGQGKQEPEDFVDFFSSESSKPSKELIQEDEKKADEEEDDDDEFSEFQSAVPVTNPANSFNLLNTSPIEGMPATTSSMPFYNSSTTDQGKITPAIAEPKKVDPFSSLFSTAKASAEAPSAPKASQAKAAASNPVSNSTTALSTDQDDDDEFGEMHGGAVQQEQNTNNNHTSSKEIDLLSF D666ECB1C0D074FE D666ECB1C0D074FE yent3p-yvti1p-1 3 8 unspecified role unspecified role unspecified role unspecified role Region 28-170 Region 28-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 3-99 Region 3-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction yent3p-yvti1p-2 6 8 unspecified role unspecified role unspecified role unspecified role Region 28-170 Region 28-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 3-99 Region 3-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction yvti1p-yent3p-1 4 8 unspecified role unspecified role prey prey Region 1-172 Region 1-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P47160:p.Arg161Glu R161E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R161E'. Wed May 02 19:15:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg161glu' Tue Jun 30 19:19:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg161Glu' P47160:p.Arg157Glu R157E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R157E'. Wed May 02 20:32:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg157glu' Tue Jun 30 20:06:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg157Glu' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-115 Region 1-115 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yvti1p-yent3p-2 1 8 unspecified role unspecified role prey prey Region 1-172 Region 1-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Strep-tag Strep-tag strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 7 unspecified role unspecified role bait bait Region 1-115 Region 1-115 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q04338:p.Glu42Arg E42R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E42R'. Wed May 02 16:47:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu42arg' Tue Jun 30 18:36:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu42Arg' Q04338:p.Asp46Arg D46R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D46R'. Wed May 02 19:12:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp46arg' Tue Jun 30 18:46:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp46Arg' Q04338:p.Asp96Arg D96R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D96R'. Wed May 02 15:32:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp96arg' Tue Jun 30 18:54:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp96Arg' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction yvti1p-yent3p-3 2 8 unspecified role unspecified role prey prey Region 1-172 Region 1-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 7 unspecified role unspecified role bait bait Region 1-115 Region 1-115 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q04338:p.Glu42Arg E42R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain E R This feature has been corrected as a result of our quality control procedures. The original label was 'E42R'. Wed May 02 14:29:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu42arg' Tue Jun 30 20:17:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu42Arg' Q04338:p.Asp46Arg D46R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D46R'. Wed May 02 19:56:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp46arg' Tue Jun 30 16:23:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp46Arg' Q04338:p.Asp96Arg D96R mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D R This feature has been corrected as a result of our quality control procedures. The original label was 'D96R'. Wed May 02 20:09:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp96arg' Tue Jun 30 16:10:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp96Arg' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yent3p-yvti1p-3 5 8 unspecified role unspecified role unspecified role unspecified role Region 28-170 Region 28-170 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 3-99 Region 3-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction