DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218637X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218641X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218632X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218633X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218638X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218635X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218634X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218644X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218631X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218640X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218639X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218636X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218643X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. SUMOylation regulates telomere length homeostasis by targeting Cdc13. Nature structural & molecular biology 2011 imex curation Hang LE., Liu X., Cheung I., Yang Y., Zhao X. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hang LE., Liu X., Cheung I., Yang Y., Zhao X. DIP original experiment: DIP-218642X Nature structural & molecular biology 2011 IMEx SUMOylation regulates telomere length homeostasis by targeting Cdc13. rap1_yeast DNA-binding protein RAP1 RAP1 GRF1 TUF1 YNL216W N1310 SBF-E Repressor/activator site-binding protein TUF protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPDDFETAPAEYVDALDPSMVVVDSGSAAVTAPSDSAAEVKANQNEENTGATAAETSEKVDQTEVEKKDDDDTTEVGVTTTTPSIADTAATANIASTSGASVTEPTTDDTAADEKKEQVSGPPLSNMKFYLNRDADAHDSLNDIDQLARLIRANGGEVLDSKPRESKENVFIVSPYNHTNLPTVTPTYIKACCQSNSLLNMENYLVPYDNFREVVDSRLQEESHSNGVDNSNSNSDNKDSIRPKTEIISTNTNGATEDSTSEKVMVDAEQQARLQEQAQLLRQHVSSTASITSGGHNDLVQIEQPQKDTSNNNNSNVNDEDNDLLTQDNNPQTADEGNASFQAQRSMISRGALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRARNYSSQRNVQPTANAASANAAAAAAAAASNSYAIPENELLDEDTMNFISSLKNDLSNISNSLPFEYPHEIAEAIRSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL 67C4AFB03B3C0713 67C4AFB03B3C0713 slx4_yeast Structure-specific endonuclease subunit SLX4 SLX4 L3140 YLR135W Synthetic lethal of unknown function protein 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MELQRAQRNLKFLQNEDYVNVTDQTNLNGESQNAYSLGMETQVPEMQFSLSSDDDSIGTQVKSVTAQKSPMTQETTKNDTERNKDVDKSCNPVSTSHPDLGGSNIEENIFINTQIQSRLDDAEEETNLKLKLEKFKYSFKSSNADDTHSNANVTAKRRPAIRKANSKLKTKPKTKRDPKIIKNITDFNINNYERSRTASLLKQLSGKHKKVLDIIKTQNEGNSDKPPRARNNKGEKATFDTYSEQEWKDIMKLLLQKFPQSEETDLNEVQKFLYGSEKSSNSLDNQESSQQRLWTASQLPPELPDEAIQPEQEERIRDTQSAVNFLSLSQVMDDKSEIMKDEESIIISRGDSTSSQEYGNGLEPQQPVGNVVGEDIELAVGTRINAFSLTDYKACKPMSVEVSRRCENSTDNDYDNISIVSDTTDETSTLFPLDQYRYVFIENDERPPLATDTIGSTQFFTPNTSPLDGIIDLTQESFKAVRSLISPLKVENNKTGVTSQASNQVQVPATRTPTIIPQKNLTTTLKTEEEKNNIGSSIRVKLLQESVVKLNPKLVKHNFYRVEANDSEEEETEFDDQFCIADIQLVDSSKISTKDSTQNPTTSNDIIDTSAASSIASPEKFCEIMMSQSMKELRQSLKTVGLKPMRTKVEIIQSLQTASQILSTANPDNKGEHGGVANFSKIEIFDHLTELIEAFPDFLERIYTFEPIPLNELIEKLFSAEPFVSQIDEMTIREWADVQGICLRNDKK 52C0FD889C8C5835 52C0FD889C8C5835 pif1_yeast ATP-dependent DNA helicase PIF1 PIF1 Telomere stability protein 1 DNA repair and recombination helicase PIF1 Petite integration frequency protein 1 TST1 YM9958.01C YML061C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPKWIRSTLNHIIPRRPFICSFNSFLLLKNVSHAKLSFSMSSRGFRSNNFIQAQLKHPSILSKEDLDLLSDSDDWEEPDCIQLETEKQEKKIITDIHKEDPVDKKPMRDKNVMNFINKDSPLSWNDMFKPSIIQPPQLISENSFDQSSQKKSRSTGFKNPLRPALKKESSFDELQNNSISQERSLEMINENEKKKMQFGEKIAVLTQRPSFTELQNDQDDSNLNPHNGVKVKIPICLSKEQESIIKLAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLAACNIGGITIHSFAGIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFCGDFFQLPPVSKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETYFCYEALTNDPSMPPEKLETWAENPSKLKAAMEREQSDGEESAVASRKSSVKEGFAKSDIGEPVSPLDSSVFDFMKRVKTDDEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRFKASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQVKKRKLDYAPGPKYKAKSKSKSNSPAPISATTQSNNGIAAMLQRHSRKRFQLKKESNSNQVHSLVSDEPRGQDTEDHILE D7E4CAE499822C2C D7E4CAE499822C2C ku70_yeast ATP-dependent DNA helicase II subunit 1 YKU70 HDF1 NES24 YMR284W YM8021.10 ATP-dependent DNA helicase II subunit Ku70 High affinity DNA-binding factor subunit 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEAQDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEFDGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKVTQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKFNI BD58160328EE6C6E BD58160328EE6C6E smt3_yeast Ubiquitin-like protein SMT3 SMT3 D9719.15 YDR510W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY A2790DE7F315E1A7 A2790DE7F315E1A7 stn1_yeast Protein STN1 STN1 D4456 YD8554.15 YDR082W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDKYGHIAHQEGDVCYYIPRLFKYNSYYSGTEDVRIFVGDLKYRMRVSLQICEKYYDRRLSMLFWKNHPLQQIHLIGCIIGLQFKWIGKQEYIFFQLDDCTSDSSLVGYTSDMRFLTCKVKKDSILSWGLNITDLIGLTLHVYGQASLNYQELQVEYLRLCYSLTEEIDHWKITMNMREQLDTPWSLSDFVIGELFTQEQEWTPETSQIEVVNPDFVGIGYKTPESKRNETTFIEQLQEERLKDELEIISPYNSTDTSNSVHSLSFRFVSSLKDFPETHFLNSGDQIDNGNDEQLKKLEYQSANLPVMIPNRTSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDPKNGMEDQNSGILLHLEYAAAYS 61B691C8D4A2E650 61B691C8D4A2E650 ku80_yeast ATP-dependent DNA helicase II subunit 2 YKU80 HDF2 YMR106C YM9718.05C Yeast Ku80 High affinity DNA-binding factor subunit 2 ATP-dependent DNA helicase II subunit Ku80 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSESTTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQEIPNVFQIQSFLAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQFQARKILKQIVVFTDNLDDLDITDEEIDLLTEELSTRIILIDCGKDTQEERKKSNWLKLVEAIPNSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNPSGSMQDENCLCIKVEAFPATKAVSGLNRKTAVEVEDSQKKERYVGVKSIIEYEIHNEGNKKNVSEDDQSGSSYIPVTISKDSVTKAYRYGADYVVLPSVLVDQTVYESFPGLDLRGFLNREALPRYFLTSESSFITADTRLGCQSDLMAFSALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHSNINSEKKFVKSLTLCRLPFAEDERVTDFPKLLDRTTTSGVPLKKETDGHQIDELMEQFVDSMDTDELPEIPLGNYYQPIGEVTTDTTLPLPSLNKDQEENKKDPLRIPTVFVYRQQQVLLEWIHQLMINDSREFEIPELPDSLKNKISPYTHKKFDSTKLVEVLGIKKVDKLKLDSELKTELEREKIPDLETLLKRGEQHSRGSPNNSNN 58126164EE375643 58126164EE375643 rt107_yeast Regulator of Ty1 transposition protein 107 RTT107 ESC4 Establishes silent chromatin protein 4 YHR154W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTSLLFEQLNFLILVAAEAELPIAHSTRKLLMDNSCNNCQIYELYNENLKDVKTDKDWFMNKFGPQTVHFVISNTINFPFYKIVYFDLLIPVVSHTWVQDSVKTKRHLRTNMYSPNPFHLLRDCQVYISKSSFNKCEYILYSDLLHLLGGTLVNYISNRTTHVIVQSPQDPIIATVSKLTFGSFSSSSTNKHTEKPLREWKFVYPIWILYHFKMAKPLKGELATLCELDMQDTSEEQLFAKWEEVIGDKQTSSSQLTLHPNKTLFKNHHFAISPDLNFFTPLYWFLKGFIEDLDGKVTPLSFSDDLKSVYQAFPDIDCYIGHSANSPILEKTKSIKPEIHVGNVSWLFYMFALQKFTPVSQCKLIHQPFHAKLFTSKELTVAYTNYFGSQRFYIQRLVEILGGLSTPELTRKNTHLITKSTIGKKFKVAKKWSLDPQNAIIVTNHMWLEQCYMNNSKLNPKDSRFQNFKLDDNMGWNIGQIGMDHSSLPTPKNLSMVTYDTQSISEKPPPTNDQMDQINDNTNVLSKKDGTPISSFENSIDEKIDKLQKISGEVAVTHSGDLERSFVSRPSRASFPVVDSKKSNLQKKDSNSDISMETEVFCEGHEKREEKEFTKPITEYDAPKKQEIREQSRKKNDIDYKKEEEETELQVQLGQRTKREIKTSKKNEKEKETNECHIEVDQMTNEKQGEESTGKLISTEDVTSKKDTDKFSHLFEGLSDNDDHINDEKPAVNSKYTTPKTSQNITSGVDTPTTAQTQVFMPSSGNSRLAKTQAAKRLHTDIESLNEFQKNFKRKRIDSEEISLSQDVERSNNNKELATKAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDLLKQIHSKKDKLSQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDVSKQENGGIFKYVLIVTKASQVKKFTKLINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKKNN 767931285BB52580 767931285BB52580 rad52_yeast DNA repair and recombination protein RAD52 YML032C RAD52 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEIMDMDEKKPVFGNHSEDIQTKLDKKLGPEYISKRVGFGTSRIAYIEGWRVINLANQIFGYNGWSTEVKSVVIDFLDERQGKFSIGCTAIVRVTLTSGTYREDIGYGTVENERRKPAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVKFDPPDFDENNLFRPTDEISESSRTNTLHENQEQQQYPNKRRQLTKVTNTNPDSTKNLVKIENTVSRGTPMMAAPAEANSKNSSNKDTDLKSLDASKQDQDDLLDDSLMFSDDFQDDDLINMGNTNSNVLTTEKDPVVAKQSPTASSNPEAEQITFVTAKAATSVQNERYIGEESIFDPKYQAQSIRHTVDQTTSKHIPASVLKDKTMTTARDSVYEKFAPKGKQLSMKNNDKELGPHMLEGAGNQVPRETTPIKTNATAFPPAAAPRFAPPSKVVHPNGNGAVPAVPQQRSTRREVGRPKINPLHARKPT 4F5D07480A05B564 4F5D07480A05B564 cdc13_yeast Cell division control protein 13 CDC13 YDL220C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDTLEEPECPPHKNRIFVSSSKDFEGYPSKAIVPVQFVALLTSIHLTETKCLLGFSNFERRGDQSQEDQYLIKLKFKDRGSERLARITISLLCQYFDIELPDLDSDSGASPTVILRDIHLERLCFSSCKALYVSKHGNYTLFLEDIKPLDLVSVISTISTKSTNSSKHSSSELISECDLNNSLVDIFNNLIEMNRDEKNRFKFVKLIHYDIELKKFVQDQQKVLSQKSKAAAINPFFVPNRLGIPYIESQNEFNSQLMTLNVDEPTTDISNMGEEMHDSADPIEDSDSSTTSSTGKYFSSKSYIQSQTPERKTSVPNNWHDDDSGSKRKRKLSFHSPNASSIRKAISYEQLSLASVGSVERLEGKIVGMNPPQFASINEFKYCTLKLYFTQLLPNVPDKVLVPGVNCIEIVIPTRERICELFGVLNCQSDKISDILLLEKPDRISVEVERILWDNDKTASPGMAVWSLKNISTDTQAQAQVQVPAQSSASIDPSRTRMSKMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPIHRNGSHLAKLRFDEVKHEPKKSPTTPALAEHIPDLNADVSSFDVKFTDISSLLDSSARLPRPQQTHKSNTLYSCEGRIIAIEYHASDLCFHITNELPLLQTRGLAPERVLQLHIITSKNFAYFFNRSSAYLQRQPLEEKYTQLAQFLGHSFKFNITSSLTLFPDTTVALQIWCPIECTFRELQQQLAHPKVAAAPDSGSLDCAINATVNPLRLLAAQNGVTVKKEEDNDDDAGAVPTS 9FE0AD08520A6F8A 9FE0AD08520A6F8A rap1-sumo-1 9 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc13-stn1-7 2 20 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role bait bait P32797:p.Lys909Arg K909R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K909R'. Wed May 02 16:24:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys909arg' Tue Jun 30 17:02:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys909Arg' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rtt107-slx4-1 10 16 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 22 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pif1-sumo-1 12 17 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yku70-sumo-1 3 18 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association stn1-cdc13-1 14 20 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yku80-sumo-1 1 21 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yku70-sumo-2 4 18 unspecified role unspecified role bait bait TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rad52-sumo-1 5 23 unspecified role unspecified role bait bait TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc13-sumo-1 13 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 24 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P32797:p.Lys909Arg K909R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K909R'. Wed May 02 18:21:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys909arg' Tue Jun 30 19:30:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys909Arg' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc13-sumo-2 7 24 unspecified role unspecified role bait bait P32797:p.Lys909Arg K909R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K909R'. Wed May 02 14:24:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys909arg' Tue Jun 30 17:34:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys909Arg' TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yku80-sumo-2 11 21 unspecified role unspecified role bait bait TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cdc13-sumo-3 8 24 unspecified role unspecified role bait bait P32797:p.Lys909Arg K909R mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R This feature has been corrected as a result of our quality control procedures. The original label was 'K909R'. Wed May 02 19:26:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys909arg' Tue Jun 30 16:51:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys909Arg' TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pif1-sumo-2 6 17 unspecified role unspecified role bait bait TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association