DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218960X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218962X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218955X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218954X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218961X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper dls dynamic light scattering dls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218956X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218958X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218959X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. Nature 2011 imex curation Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper sls static light scattering sls predetermined predetermined participant predetermined Wollmann P., Cui S., Viswanathan R., Berninghausen O., Wells MN., Moldt M., Witte G., Butryn A., Wendler P., Beckmann R., Auble DT., Hopfner KP. DIP original experiment: DIP-218957X Nature 2011 IMEx Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP. q8svz5_enccu ECU03_1530 protein protein enccu Encephalitozoon cuniculi (strain GB-M1) Microsporidian parasite MNRLEKFFTTLNTAQSKVLKGYTTDELVSQIKEYVDFTPYILKQTYRLLCGQASEDRRNGARILRSLMFQFKLVTDFKIEYKESSSIYLSSTGEQFNVQAPSIQEQKRMVRKIAKLEHVEANFLSDIDFKAGSGEAIKRHKVDERPIENVLDFFEQISDNLLSYEWYKRHGAFLAFAAMFSEIDNGGDIQIRVDSKLFSKIYEILVTDKFNDFVDDRTVAPVRDAAAYLLSRIYPLIGPNDIIEQLVGFLDSGDWQVQFSGLIALGYLKEFVEDKDGLCRKLVSLLSSPDEDIKLLSAELLCHFPITDSLDLVLEKCWKNIESEELISVSKTSNLSLLTKIYRENPELSIPPERLKDIFPCFTSPVPEVRTSILNMVKNLSEESIDFLVAEVVLIEEKDEIREMAIKLLKKRRDLPKNLILHFMNVIGGSLYEPYSEDDFVSYEDLYFTKSGINVVGKDEILKNRCLLFECIMKSGLPDLQSTIETTTSRTFISLYRSVQALVKDTPYTPANIEELEYYFDRCKDLKMAPLKEFKKKLSAPGIRSIHPMVDPLYSDYTRMVASIEFPGLERATALFEVETCKQFLHLFSKMITEYYDAEKISIDNFLLKAYEGLASGKDGFLSFFEVFNTRLLAHSFFHKIGSLENRLDFFSKTIHIYTKTSQIQKIGFVFDDALREKNITVINGFMRSLEFNEKFVRKALEDLDVELLDAVLMSGDHSFNPLFVKPLLRNISGNIDREASSKVLSKVIPTLGFSTNTKISKDLLEMIEREKKSLESLLDAGKIPEYHIKCPISVKLRDYQMEGVKWLNFLYSFSLNGILADDMGLGKTLQVLTFLCSEIYKTNRKVLVICPSSLTGHWKSEVKKFFPFVAAEIYKREDRDTYSILISSYETFRNDYLNFIEKDWFYVVVDEGHVLRNKQTILYSRMNMIRCSRKMVLTGTPVHNSVEDLISLFNFLMPNYIGPEKEYGSLNVKMSDSEIEKTHKRLDLLHRKVLPFILRRLKIDVLKDLPPKIIRDITVELGPVQEKLYREIDEKGGKESLGDAELEYGKVDQKNVGFKRTRDLFLAVSHIGHFKDSTEVSCKVKALEDIISLCGGEDLGSKILIFFQFKSTIDLVIKDIMKKYKFKYSRLDGSVPSAARTKIAEEFNTGTTQMLFLTTQVGGLGLNLTGADTVVMYEHDWNPFNDLQAMDRAHRIGQKRTVNVFRFIARNTLEEKVMNLQSFKMFVANSLVSQQNADIETMDTKDLLERFQVPG DIP protein Q8SVZ5 original sequence version: 58 q8st28_enccu ECU04_1440 protein protein enccu Encephalitozoon cuniculi (strain GB-M1) Microsporidian parasite MDAPDISYEHQETSVPNRSGIIPTLQNVVATVNLSCKLDLKNIALRARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVITGAKSEKSSRMAAQRYAKIIHKLGFNATFDDFKIQNIVSSCDIKFSIRLEGLAYAHSNYCSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKVRDDIYQAFNNIYPVLIQHRKA DIP protein Q8ST28 original sequence version: 59 q8st28_enccu-1 2 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q8st28_enccu-q8svz5_enccu-1 4 11 unspecified role unspecified role unspecified role unspecified role Q8ST28:p.Lys103Glu K103E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K103E'. Wed May 02 19:18:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys103glu' Tue Jun 30 19:35:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys103Glu' ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction q8svz5_enccu-1 6 10 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction q8st28_enccu-q8svz5_enccu-2 8 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction q8svz5_enccu-2 9 10 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction q8st28_enccu-q8svz5_enccu-3 3 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction q8st28_enccu-q8svz5_enccu-4 1 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role N-terminal domain Region 1-779 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction q8st28_enccu-q8svz5_enccu-5 7 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Region 1-1016 Region 1-1016 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction q8st28_enccu-2 5 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction