DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Architecture of the Mediator head module. Architecture of the Mediator head module. Nature 2011 imex curation Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. DIP original experiment: DIP-248960X Nature 2011 IMEx Architecture of the Mediator head module. Architecture of the Mediator head module. Architecture of the Mediator head module. Nature 2011 imex curation Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. DIP original experiment: DIP-248958X Nature 2011 IMEx Architecture of the Mediator head module. Architecture of the Mediator head module. Architecture of the Mediator head module. Nature 2011 imex curation Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper tem transmission electron microscopy tem predetermined predetermined participant predetermined Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. DIP original experiment: DIP-248962X Nature 2011 IMEx Architecture of the Mediator head module. Architecture of the Mediator head module. Architecture of the Mediator head module. Nature 2011 imex curation Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. DIP original experiment: DIP-248961X Nature 2011 IMEx Architecture of the Mediator head module. Architecture of the Mediator head module. Architecture of the Mediator head module. Nature 2011 imex curation Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Imasaki T., Calero G., Cai G., Tsai KL., Yamada K., Cardelli F., Erdjument-Bromage H., Tempst P., Berger I., Kornberg GL., Asturias FJ., Kornberg RD., Takagi Y. DIP original experiment: DIP-248959X Nature 2011 IMEx Architecture of the Mediator head module. med17_yeast Mediator of RNA polymerase II transcription subunit 17 YER022W SRB4 MED17 Mediator complex subunit 17 Suppressor of RNA polymerase B 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTEDPDSNHLSSETGIKLALDPNLITLALSSNPNSSLHSPTSDEPVPESAGKADTSIRLEGDELENKTKKDNDKNLKFLKNKDSLVSNPHEIYGSMPLEQLIPIILRQRGPGFKFVDLNEKELQNEIKQLGSDSSDGHNSEKKDTDGADENVQIGEDFMEVDYEDKDNPVDSRNETDHKTNENGETDDNIETVMTQEQFVKRRRDMLEHINLAMNESSLALEFVSLLLSSVKESTGMSSMSPFLRKVVKPSSLNSDKIPYVAPTKKEYIELDILNKGWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNKDVIFKIRDRTSGQKLLAIKYGYEDSGSTYKHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRIFTKIESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKIIFEKELMYQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPKINDKRANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYKLLLKKIIKDYVLDIVPGSSITETEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRRELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTTFSDFKEVEDFLHFIVAEYIQQKKV D25B2993A1BADFD6 D25B2993A1BADFD6 med18_yeast Mediator of RNA polymerase II transcription subunit 18 YGR104C SRB5 MED18 Mediator complex subunit 18 Suppressor of RNA polymerase B 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI B1148FC187C2802A B1148FC187C2802A med11_yeast Mediator of RNA polymerase II transcription subunit 11 YMR112C YM9718.11C Mediator complex subunit 11 MED11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQPPYIQERLKSLNDIETQLCSMLQEASQVTFIFGELKRGNESVKPQFENHVKQFYERLDKSTTQLRKEIQLLDENVGTRLLPINVNKKALGQDTEKMEEQLDLLSAILDPSKSK 457D13C6030F33CC 457D13C6030F33CC med20_yeast Mediator of RNA polymerase II transcription subunit 20 YHR041C SRB2 HRS2 MED20 Mediator complex subunit 20 Suppressor of RNA polymerase B 2 Hyper-recombination suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL C30BF309D43AFB2A C30BF309D43AFB2A med8_yeast Mediator of RNA polymerase II transcription subunit 8 YBR193C YBR1403 MED8 Mediator complex subunit 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN 86B2A064293C6B61 86B2A064293C6B61 med6_yeast Mediator of RNA polymerase II transcription subunit 6 MTR32 YHR058C Mediator complex subunit 6 MED6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQRQFSQLNDPNAAVNMTQNIMTLPDGKNGNLEEEFAYVDPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQRRTNNSGVGSAKGPEIIPLQDYYIIGANIYQSPTIFKIVQSRLMSTSYHLNSTLESLYDLIEFQPSQGVHYKVPTDTSTTATAATNGNNAGGGSNKSSVRPTGGANMATVPSTTNVNMTVNTMGTGGQTIDNGTGRTGNGNMGITTEMLDKLMVTSIRSTPNYI B84E87DCC2737849 B84E87DCC2737849 med22_yeast Mediator of RNA polymerase II transcription subunit 22 SRB6 YBR253W YBR1721 MED22 Mediator complex subunit 22 Suppressor of RNA polymerase B 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNQALYEKLEQTRTILSVKLAELINMTTIADRNDDDEGSFAQENSELAVATTSVMMVNNQTMQLIKNVQDLLILTRSIKEKWLLNQIPVTEHSKVTRFDEKQIEELLDNCIETFVAEKTT 7703E4FAE101A31F 7703E4FAE101A31F med11-med17-7 2 12 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 7 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role unspecified role unspecified role Region 109-687 Region 109-687 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 11 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association med17-med11-4 4 12 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 303-687 Region 303-687 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association med17-med11-5 5 12 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 11 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association med17-med11-6 1 9 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 7 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 12 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 1-400 Region 1-400 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 201-687 Region 201-687 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper 11 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper association association med11-med17-8 3 12 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 9 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 7 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 6 unspecified role unspecified role unspecified role unspecified role Region 1-400 Region 1-400 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 8 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 10 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper 11 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association