DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218620X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218617X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218613X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218618X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218616X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218614X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218621X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218612X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218619X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. Nature structural & molecular biology 2011 imex curation Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Kosloff M., Travis AM., Bosch DE., Siderovski DP., Arshavsky VY. DIP original experiment: DIP-218615X Nature structural & molecular biology 2011 IMEx Integrating energy calculations with functional assays to decipher the specificity of G protein-RGS protein interactions. rgs18_human Regulator of G-protein signaling 18 RGS18 RGS13 protein protein human Homo sapiens Human METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL DIP protein Q9NS28 original sequence version: 86 rgs4_human Regulator of G-protein signaling 4 RGS4 protein protein human Homo sapiens Human MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA DIP protein P49798 original sequence version: 102 DIP protein P49798 original sequence version: 106 7713F1F7496A698B rgs8_human Regulator of G-protein signaling 8 RGS8 protein protein human Homo sapiens Human MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS DIP protein P57771 original sequence version: 86 198965B4C27F64C9 rgs17_human Regulator of G-protein signaling 17 RGS17 RGSZ2 protein protein human Homo sapiens Human MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES DIP protein Q9UGC6 original sequence version: 98 0AFA22A43BF5E481 rgs10_human Regulator of G-protein signaling 10 RGS10 protein protein human Homo sapiens Human MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT DIP protein O43665 original sequence version: 100 D83CCB98A6EE2182 rgs14_human Regulator of G-protein signaling 14 RGS14 protein protein human Homo sapiens Human MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQPVASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNSTTDSAL DIP protein O43566 original sequence version: 107 DIP protein O43566 original sequence version: 130 811296228B479C3D gnao_rat Guanine nucleotide-binding protein G(o) subunit alpha Gnao1 Gna0 Gnao protein protein rat Rattus norvegicus (Rat) Rat MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKADSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY DIP protein P59215 original sequence version: 119 DIP protein P59215 original sequence version: 86 mint Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear homomint 577024F61B179C89 rgs16_human Regulator of G-protein signaling 16 RGS16 RGSR A28-RGS14P Retinal-specific RGS Retinally abundant regulator of G-protein signaling protein protein human Homo sapiens Human MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT DIP protein O15492 original sequence version: 97 19B384E935F3E5D1 rgs7_human Regulator of G-protein signaling 7 RGS7 protein protein human Homo sapiens Human MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPPDPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPCHKNCTPTLRASTNLL DIP protein P49802 original sequence version: 117 1FCC2D60622675DE rgs1_human Regulator of G-protein signaling 1 Early response protein 1R20 B-cell activation protein BL34 RGS1 1R20 BL34 IER1 protein protein human Homo sapiens Human MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK DIP protein Q08116 original sequence version: 111 D8D7D8E80819496A gnao1-rgs1-1 8 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 20 unspecified role unspecified role unspecified role unspecified role RGS domain Region 85-200 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gnao1-rgs7-1 6 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role RGS domain Region 333-448 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gnao1-rgs10-1 5 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 15 unspecified role unspecified role unspecified role unspecified role RGS domain Region 33-148 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gnao1-rgs18-1 1 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role RGS domain Region 86-202 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg;Gln186Lys] K141E/H156E/K158R/Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q K certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K141E/H156E/K158R/Q186K'. Wed May 02 20:20:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu,his156glu,lys158arg,gln186lys' Tue Jun 30 15:53:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys141Glu;His156Glu;Lys158Arg;Gln186Lys]' Q9NS28:p.Gln186Lys Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q K This feature has been corrected as a result of our quality control procedures. The original label was 'Q186K'. Wed May 02 16:46:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln186lys' Tue Jun 30 19:55:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln186Lys' Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg] K141E/H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K141E/H156E/K158R'. Wed May 02 14:48:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu,his156glu,lys158arg' Tue Jun 30 16:34:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys141Glu;His156Glu;Lys158Arg]' Q9NS28:p.[His156Glu;Lys158Arg] H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain H E This feature has been corrected as a result of our quality control procedures. The original label was 'H156E/K158R'. Wed May 02 15:03:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his156glu,lys158arg' Tue Jun 30 16:46:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His156Glu;Lys158Arg]' ecolx Escherichia coli direct interaction direct interaction gnao1-rgs4-1 3 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role RGS domain Region 62-178 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P49798:p.Asn128Ser N128S mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N S This feature has been corrected as a result of our quality control procedures. The original label was 'N128S'. Wed May 02 16:52:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn128ser' Tue Jun 30 18:16:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn128Ser' P49798:p.[Glu126Ala;Arg134Ala;Arg166Ala] E126A/R134A/R166A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E126A/R134A/R166A'. Wed May 02 18:32:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu126ala,arg134ala,arg166ala' Tue Jun 30 16:13:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu126Ala;Arg134Ala;Arg166Ala]' P49798:p.Arg134Ala R134A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R134A'. Wed May 02 15:30:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg134ala' Tue Jun 30 17:45:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg134Ala' P49798:p.[Arg134Ala;Arg166Ala] R134A/R166A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R134A/R166A'. Wed May 02 17:45:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg134ala,arg166ala' Tue Jun 30 17:43:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg134Ala;Arg166Ala]' ecolx Escherichia coli direct interaction direct interaction gnao1-rgs17-1 9 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role RGS domain Region 84-200 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9UGC6:p.[Ile143Ser;Leu144Glu;Ser145Ala;Ser150Asn;His183Glu;Arg184Lys;Asn192Lys] I143S/L144E/S145A/S150N/H183E/R184K/N192K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N K certain certain sequence position certain certain certain sequence position certain R K certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain S N certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain I S This feature has been corrected as a result of our quality control procedures. The original label was 'I143S/L144E/S145A/S150N/H183E/R184K/N192K'. Wed May 02 18:52:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile143ser,leu144glu,ser145ala,ser150asn,his183glu,arg184lys,asn192lys' Tue Jun 30 17:37:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile143Ser;Leu144Glu;Ser145Ala;Ser150Asn;His183Glu;Arg184Lys;Asn192Lys]' Q9UGC6:p.[Ile143Ser;Leu144Glu;Ser145Ala;Ser150Asn;Asn192Lys] I143S/L144E/S145A/S150N/N192K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N K certain certain sequence position certain certain certain sequence position certain S N certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain I S This feature has been corrected as a result of our quality control procedures. The original label was 'I143S/L144E/S145A/S150N/N192K'. Wed May 02 18:53:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile143ser,leu144glu,ser145ala,ser150asn,asn192lys' Tue Jun 30 16:29:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile143Ser;Leu144Glu;Ser145Ala;Ser150Asn;Asn192Lys]' ecolx Escherichia coli direct interaction direct interaction gnao1-rgs14-1 2 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role RGS domain Region 67-184 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gnao1-rgs18-2 7 17 unspecified role unspecified role bait bait ecolx Escherichia coli 11 unspecified role unspecified role prey prey Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg;Gln186Lys] K141E/H156E/K158R/Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q K certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K141E/H156E/K158R/Q186K'. Wed May 02 14:48:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu,his156glu,lys158arg,gln186lys' Tue Jun 30 20:12:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys141Glu;His156Glu;Lys158Arg;Gln186Lys]' Q9NS28:p.Gln186Lys Q186K mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q K This feature has been corrected as a result of our quality control procedures. The original label was 'Q186K'. Wed May 02 17:24:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln186lys' Tue Jun 30 15:44:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln186Lys' Q9NS28:p.[Lys141Glu;His156Glu;Lys158Arg] K141E/H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K141E/H156E/K158R'. Wed May 02 20:15:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys141glu,his156glu,lys158arg' Tue Jun 30 16:29:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys141Glu;His156Glu;Lys158Arg]' Q9NS28:p.[His156Glu;Lys158Arg] H156E/K158R mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain H E This feature has been corrected as a result of our quality control procedures. The original label was 'H156E/K158R'. Wed May 02 17:33:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his156glu,lys158arg' Tue Jun 30 19:45:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His156Glu;Lys158Arg]' ecolx Escherichia coli direct interaction direct interaction gnao1-rgs8-1 10 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 13 unspecified role unspecified role unspecified role unspecified role RGS domain Region 56-171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gnao1-rgs16-3 4 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 18 unspecified role unspecified role unspecified role unspecified role RGS domain Region 65-181 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O15492:p.Glu90Ala E90A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E90A'. Wed May 02 17:08:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu90ala' Tue Jun 30 18:09:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu90Ala' O15492:p.[Glu125Ala;Glu129Ala;Lys173Ala] E125A/E129A/K173A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E125A/E129A/K173A'. Wed May 02 15:56:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu125ala,glu129ala,lys173ala' Tue Jun 30 17:58:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu125Ala;Glu129Ala;Lys173Ala]' O15492:p.[Glu125Ala;Glu129Ala] E125A/E129A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E125A/E129A'. Wed May 02 18:08:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu125ala,glu129ala' Tue Jun 30 19:12:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu125Ala;Glu129Ala]' O15492:p.Glu129Ala E129A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E129A'. Wed May 02 17:46:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu129ala' Tue Jun 30 16:02:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu129Ala' ecolx Escherichia coli direct interaction direct interaction