DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219053X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219049X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219052X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219048X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219050X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219051X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219055X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. Nature 2011 imex curation Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. Only protein-protein interactions in vitro In vitro epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Phan G., Remaut H., Wang T., Allen WJ., Pirker KF., Lebedev A., Henderson NS., Geibel S., Volkan E., Yan J., Kunze MB., Pinkner JS., Ford B., Kay CW., Li H., Hultgren SJ., Thanassi DG., Waksman G. DIP original experiment: DIP-219054X Nature 2011 IMEx Crystal structure of the FimD usher bound to its cognate FimC-FimH substrate. fimg_ecoli Protein FimG fimG b4319 JW4282 protein protein ecoli Escherichia coli (strain K12) MKWCKRGYVLAAILALASATIQAADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS 8C3EF95FD442E22C 8C3EF95FD442E22C fimc_ecoli Chaperone protein FimC fimC b4316 JW4279 protein protein ecoli Escherichia coli (strain K12) MSNKNVNVRKSQEITFCLLAGILMFMAMMVAGRAEAGVALGATRVIYPAGQKQEQLAVTNNDENSTYLIQSWVENADGVKDGRFIVTPPLFAMKGKKENTLRILDATNNQLPQDRESLFWMNVKAIPSMDKSKLTENTLQLAIISRIKLYYRPAKLALPPDQAAEKLRFRRSANSLTLINPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPSDAGSNITYRTINDYGALTPKMTGVME DIP protein P31697 original sequence version: 103 DIP protein P31697 original sequence version: 119 B1AD63C33C8FACB4 fimd_ecoli Outer membrane usher protein FimD fimD b4317 JW5780 protein protein ecoli Escherichia coli (strain K12) MSYLNLRLYQRNTQCLHIRKHRLAGFFVRLVVACAFAAQAPLSSADLYFNPRFLADDPQAVADLSRFENGQELPPGTYRVDIYLNNGYMATRDVTFNTGDSEQGIVPCLTRAQLASMGLNTASVAGMNLLADDACVPLTTMVQDATAHLDVGQQRLNLTIPQAFMSNRARGYIPPELWDPGINAGLLNYNFSGNSVQNRIGGNSHYAYLNLQSGLNIGAWRLRDNTTWSYNSSDRSSGSKNKWQHINTWLERDIIPLRSRLTLGDGYTQGDIFDGINFRGAQLASDDNMLPDSQRGFAPVIHGIARGTAQVTIKQNGYDIYNSTVPPGPFTINDIYAAGNSGDLQVTIKEADGSTQIFTVPYSSVPLLQREGHTRYSITAGEYRSGNAQQEKTRFFQSTLLHGLPAGWTIYGGTQLADRYRAFNFGIGKNMGALGALSVDMTQANSTLPDDSQHDGQSVRFLYNKSLNESGTNIQLVGYRYSTSGYFNFADTTYSRMNGYNIETQDGVIQVKPKFTDYYNLAYNKRGKLQLTVTQQLGRTSTLYLSGSHQTYWGTSNVDEQFQAGLNTAFEDINWTLSYSLTKNAWQKGRDQMLALNVNIPFSHWLRSDSKSQWRHASASYSMSHDLNGRMTNLAGVYGTLLEDNNLSYSVQTGYAGGGDGNSGSTGYATLNYRGGYGNANIGYSHSDDIKQLYYGVSGGVLAHANGVTLGQPLNDTVVLVKAPGAKDAKVENQTGVRTDWRGYAVLPYATEYRENRVALDTNTLADNVDLDNAVANVVPTRGAIVRAEFKARVGIKLLMTLTHNNKPLPFGAMVTSESSQSSGIVADNGQVYLSGMPLAGKVQVKWGEEENAHCVANYQLPPESQQQLLTQLSAECR DIP protein P30130 original sequence version: 94 DIP protein P30130 original sequence version: 109 DIP protein P30130 original sequence version: null B2B86CC44FAB7B0F fimh_ecoli Type 1 fimbrin D-mannose specific adhesin fimH Protein FimH JW4283 b4320 protein protein ecoli Escherichia coli (strain K12) MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ DIP protein P08191 original sequence version: 96 DIP protein P08191 original sequence version: 112 939204A51658747D fimc-fimd-3 4 11 unspecified role unspecified role unspecified role unspecified role Mature protein Region 46-878 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Mature protein Region 37-241 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Mature protein Region 22-300 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fimc-fimd-4 3 11 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association fimc-fimd-5 7 11 unspecified role unspecified role unspecified role unspecified role MTSSL-label MTSSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role MTSSL-label MTSSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association fimd-fimc-1 6 11 unspecified role unspecified role bait bait Mature protein Region 46-878 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey Mature protein Region 37-241 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Mature protein Region 22-300 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association fimc-fimd-6 5 11 unspecified role unspecified role prey prey Mature protein Region 46-878 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 10 unspecified role unspecified role bait bait Mature protein Region 37-241 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey Mature protein Region 22-300 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli association association fimc-fimg-2 1 9 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction fimc-fimd-7 8 11 unspecified role unspecified role unspecified role unspecified role MTSSL-label MTSSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role MTSSL-label MTSSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction fimc-fimd-8 2 11 unspecified role unspecified role unspecified role unspecified role Mature protein Region 46-878 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role Mature protein Region 37-241 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 12 unspecified role unspecified role unspecified role unspecified role Mature protein Region 22-300 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association