DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. DIP original experiment: DIP-253952X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Capstick DS., Jomaa A., Hanke C., Ortega J., Elliot MA. DIP original experiment: DIP-253953X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Dual amyloid domains promote differential functioning of the chaplin proteins during Streptomyces aerial morphogenesis. chph_strco Chaplin-H chpH SCO1675 protein protein strco Streptomyces coelicolor A3(2) MLKKVVAAAAATGGLVLAGAGMAVADSGAQGAAVHSPGVLSGNVVQVPVHVPVNVCGNTISVIGLLNPAFGNVCINK DIP protein Q9AD92 original sequence version: 35 q9ad92_strco-1 1 3 unspecified role unspecified role unspecified role unspecified role Region 38-54 Region 38-54 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 57-72 Region 57-72 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9AD92:p.Val62Ala V62A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V62A'. Wed May 02 14:34:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val62ala' Tue Jun 30 19:33:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val62Ala' Q9AD92:p.Val62_Leu66delinsAlaAlaAlaAlaAla V62A/I63A/G64A/L65A/L66A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain VIGLL AAAAA Fri Jul 28 10:49:01 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'V62A/I63A/G64A/L65A/L66A' Wed May 02 19:36:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_ile_gly_leu_leu62-66ala_ala_ala_ala_ala' Tue Jun 30 16:11:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val62_Leu66delinsAlaAlaAlaAlaAla' in vitro In vitro direct interaction direct interaction q9ad92_strco-2 2 3 unspecified role unspecified role unspecified role unspecified role Region 38-54 Region 38-54 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 57-72 Region 57-72 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9AD92:p.Val62_Leu66delinsAlaAlaAlaAlaAla V62A/I63A/G64A/L65A/L66A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain VIGLL AAAAA Fri Jul 28 10:52:45 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'V62A/I63A/G64A/L65A/L66A' Wed May 02 17:05:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_ile_gly_leu_leu62-66ala_ala_ala_ala_ala' Tue Jun 30 15:41:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val62_Leu66delinsAlaAlaAlaAlaAla' Q9AD92:p.Val62Ala V62A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V62A'. Wed May 02 18:41:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val62ala' Tue Jun 30 17:22:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val62Ala' in vitro In vitro direct interaction direct interaction