DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. DIP original experiment: DIP-253691X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli epr electron paramagnetic resonance ESR EPR EPR ESR epr predetermined predetermined participant predetermined Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. DIP original experiment: DIP-253692X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. DIP original experiment: DIP-253693X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Boura E., Rózycki B., Herrick DZ., Chung HS., Vecer J., Eaton WA., Cafiso DS., Hummer G., Hurley JH. DIP original experiment: DIP-253690X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy. stp22_yeast Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease STP22 VPS23 YCL008C YCL8C Vacuolar protein sorting-associated protein 23 ESCRT-I complex subunit VPS23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSANGKISVPEAVVNWLFKVIQPIYNDGRTTFHDSLALLDNFHSLRPRTRVFTHSDGTPQLLLSIYGTISTGEDGSSPHSIPVIMWVPSMYPVKPPFISINLENFDMNTISSSLPIQEYIDSNGWIALPILHCWDPAAMNLIMVVQELMSLLHEPPQDQAPSLPPKPNTQLQQEQNTPPLPPKPKSPHLKPPLPPPPPPQPASNALDLMDMDNTDISPTNHHEMLQNLQTVVNELYREDVDYVADKILTRQTVMQESIARFHEIIAIDKNHLRAVEQAIEQTMHSLNAQIDVLTANRAKVQQFSSTSHVDDEDVNSIAVAKTDGLNQLYNLVAQDYALTDTIECLSRMLHRGTIPLDTFVKQGRELARQQFLVRWHIQRITSPLS FEDE3BE79F063BCE FEDE3BE79F063BCE vps28_yeast Vacuolar protein sorting-associated protein 28 VPS28 VPT28 YPL065W LPE5W ESCRT-I complex subunit VPS28 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQKHNIKLNQNQDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFCDTYNITASNAITRLERGIPITAEHAISTTTSAPSGDNKQSSSSDKKFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD DE091D3F60C9D132 DE091D3F60C9D132 srn2_yeast Protein SRN2 SRN2 ESCRT-I complex subunit VPS37 SRN10 Vacuolar protein sorting-associated protein 37 VPS37 L2958 L9233.5 YLR119W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKVKATKLRIKQRRKNKGLNISRLDIIRAEMDVVPSPGLPEKVNEKSKNIPLPEGINLLSSKEIIDLIQTHRHQLELYVTKFNPLTDFAGKIHAFRDQFKQLEENFEDLHEQKDKVQALLENCRILESKYVASWQDYHSEFSKKYGDIALKKKLEQNTKKLDEESSQLETTTRSIDSADDLDQFIKNYLDIRTQYHLRREKLATWDKQGNLKY 4E99806CED03E345 4E99806CED03E345 mvb12_yeast Multivesicular body sorting factor 12 YGR206W G7740 12 kDa multivesicular body sorting factor ESCRT-I complex subunit MVB12 MVB12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNNVEELLRRIPLYNKYGKDFPQETVTRFQMPEFKLPALQPTRDLLCPWYEECDNITKVCQLHDSSNKKFDQWYKEQYLSKKPPGIVGNTLLSPSRKDNS E48B085E0FACBAC8 E48B085E0FACBAC8 mvb12-vps23-2 4 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association vps23-vps37-1 2 7 unspecified role unspecified role unspecified role unspecified role MTSL-label MTSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role unspecified role unspecified role MTSL-label MTSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vps28-vps37-1 3 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept Alexa594-label Alexa594-label alexa 594 label alexa 594 label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role fluorescence donor fluorescence donor Alexa488-label Alexa488-label alexa 488 label alexa 488 label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction vps28-vps37-2 1 7 unspecified role unspecified role unspecified role unspecified role MTSL-label MTSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role MTSL-label MTSL-label r1 spin label r1 spin label certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction