DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Nature structural & molecular biology 2011 imex curation Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. DIP original experiment: DIP-249045X Nature structural & molecular biology 2011 IMEx Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Nature structural & molecular biology 2011 imex curation Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. DIP original experiment: DIP-249042X Nature structural & molecular biology 2011 IMEx Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Nature structural & molecular biology 2011 imex curation Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. DIP original experiment: DIP-249043X Nature structural & molecular biology 2011 IMEx Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Nature structural & molecular biology 2011 imex curation Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. DIP original experiment: DIP-249048X Nature structural & molecular biology 2011 IMEx Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Nature structural & molecular biology 2011 imex curation Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. DIP original experiment: DIP-249047X Nature structural & molecular biology 2011 IMEx Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Nature structural & molecular biology 2011 imex curation Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. Only protein-protein interactions human Homo sapiens Human ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom ms participant Identification by mass spectrometry ms participant Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. DIP original experiment: DIP-249046X Nature structural & molecular biology 2011 IMEx Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Structure of C3PO and mechanism of human RISC activation. Nature structural & molecular biology 2011 imex curation Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ye X., Huang N., Liu Y., Paroo Z., Huerta C., Li P., Chen S., Liu Q., Zhang H. DIP original experiment: DIP-249044X Nature structural & molecular biology 2011 IMEx Structure of C3PO and mechanism of human RISC activation. tsnax_human Translin-associated protein X Translin-associated factor X TSNAX TRAX protein protein human Homo sapiens Human MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS D38B0DD96B50C0B9 DIP protein Q99598 original sequence version: 139 DIP protein Q99598 original sequence version: 93 The protein could not be merged with EBI-12908040 because of some conflicts with the protein sequence (features which cannot be shifted). D38B0DD96B50C0B9 ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA DIP protein Q9UKV8 original sequence version: 1(def) DIP protein Q9UKV8 original sequence version: 44 DIP protein Q9UKV8 original sequence version: 60 DIP protein Q9UKV8 original sequence version: 62 DIP protein Q9UKV8 original sequence version: 89 DIP protein Q9UKV8 original sequence version: 85 DIP protein Q9UKV8 original sequence version: 87 DIP protein Q9UKV8 original sequence version: 99 DIP protein Q9UKV8 original sequence version: 117 DIP protein Q9UKV8-1 original sequence version: 117 DIP protein Q9UKV8 original sequence version: 145 DIP protein Q9UKV8 original sequence version: 108 5C8552C43FC81345 tsn_human Translin TSN Component 3 of promoter of RISC protein protein human Homo sapiens Human MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGFNKETAAACVEK DIP protein Q15631 original sequence version: 94 3CAAF20BED7C4939 tsnax-tsn-3 2 8 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range [EBI-13306910]N-terminal positions must always be 1. Actual positions : 0-0 [EBI-13306910]0-0 ecolx Escherichia coli 10 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association ago2-tsn-1 5 9 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 8 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range [EBI-13306928]N-terminal positions must always be 1. Actual positions : 0-0 [EBI-13306928]0-0 ecolx Escherichia coli 10 unspecified role unspecified role prey prey ecolx Escherichia coli association association tsn-tsnax-3 1 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tsn-tsnax-4 4 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 10 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human direct interaction direct interaction tsn-tsnax-5 3 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction tsn-tsnax-6 6 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 10 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association tsn-tsnax-7 7 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 10 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction