DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219000X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-218999X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219004X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219005X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219002X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219001X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219003X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Sequential interactions with Sec23 control the direction of vesicle traffic. Nature 2011 imex curation Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lord C., Bhandari D., Menon S., Ghassemian M., Nycz D., Hay J., Ghosh P., Ferro-Novick S. DIP original experiment: DIP-219006X Nature 2011 IMEx Sequential interactions with Sec23 control the direction of vesicle traffic. hrr25_yeast Casein kinase I homolog HRR25 YPL204W HRR25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETLCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTMLRYTKAMVEKQRDLLIEKGDLNANSNAASASNSTDNKSETFNKIKLLAMKKFPTHFHYYKNEDKHNPSPEEIKQQTILNNNAASSLPEELLNALDKGMENLRQQQPQQQVQSSQPQPQPQQLQQQPNGQRPNYYPEPLLQQQQRDSQEQQQQVPMATTRATQYPPQINSNNFNTNQASVPPQMRSNPQQPPQDKPAGQSIWL C4D3107A470E8BAF C4D3107A470E8BAF trs33_yeast Trafficking protein particle complex subunit 33 TRS33 YOR115C O3251 YOR3251C Transport protein particle 33 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSTHSNNVGHPQSSPQGPLTEQQRAQQQYQIFENSLPKVSQSVYQMLLNEMVPLAMGIERQISGDVISSDSNVTSENGNINNMIKRLKIEEHHTVDIIRSHNLIHELYKADEEEKEKVLARLRNIGFQIGLKLSELLIFSNNPNLKFKEMDLLLIMKFICRDVWKQIFGKQIDNLKTNHRGTFYLLDYDYRPIQSFSLEEDAKNEELKMIEPFLEIPVGIIRGVLSSLGYSSEEVICLASFIDRPTDRPKTAFPKGVSFHVQVTMPQ 2480F69D7A48D363 2480F69D7A48D363 sec24_yeast Protein transport protein SEC24 SEC24 Abnormal nuclear morphology 1 ANU1 YIL109C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHHKKRVYPQAQLQYGQNATPLQQPAQFMPPQDPAAAGMSYGQMGMPPQGAVPSMGQQQFLTPAQEQLHQQIDQATTSMNDMHLHNVPLVDPNAYMQPQVPVQMGTPLQQQQQPMAAPAYGQPSAAMGQNMRPMNQLYPIDLLTELPPPITDLTLPPPPLVIPPERMLVPSELSNASPDYIRSTLNAVPKNSSLLKKSKLPFGLVIRPYQHLYDDIDPPPLNEDGLIVRCRRCRSYMNPFVTFIEQGRRWRCNFCRLANDVPMQMDQSDPNDPKSRYDRNEIKCAVMEYMAPKEYTLRQPPPATYCFLIDVSQSSIKSGLLATTINTLLQNLDSIPNHDERTRISILCVDNAIHYFKIPLDSENNEESADQINMMDIADLEEPFLPRPNSMVVSLKACRQNIETLLTKIPQIFQSNLITNFALGPALKSAYHLIGGVGGKIIVVSGTLPNLGIGKLQRRNESGVVNTSKETAQLLSCQDSFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFTAGQTHFYPGFSGKNPNDIVKFSTEFAKHISMDFCMETVMRARGSTGLRMSRFYGHFFNRSSDLCAFSTMPRDQSYLFEVNVDESIMADYCYVQVAVLLSLNNSQRRIRIITLAMPTTESLAEVYASADQLAIASFYNSKAVEKALNSSLDDARVLINKSVQDILATYKKEIVVSNTAGGAPLRLCANLRMFPLLMHSLTKHMAFRSGIVPSDHRASALNNLESLPLKYLIKNIYPDVYSLHDMADEAGLPVQTEDGEATGTIVLPQPINATSSLFERYGLYLIDNGNELFLWMGGDAVPALVFDVFGTQDIFDIPIGKQEIPVVENSEFNQRVRNIINQLRNHDDVITYQSLYIVRGASLSEPVNHASAREVATLRLWASSTLVEDKILNNESYREFLQIMKARISK 35E2BDD24CC75899 35E2BDD24CC75899 sar1_yeast Small COPII coat GTPase SAR1 YPL218W SAR1 GTP-binding protein SAR1 Secretion-associated RAS-related protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGWDIFGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI E2348B57896B5A13 E2348B57896B5A13 sec23_yeast Protein transport protein SEC23 SEC23 P9705.14 YPR181C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDFETNEDINGVRFTWNVFPSTRSDANSNVVPVGCLYTPLKEYDELNVAPYNPVVCSGPHCKSILNPYCVIDPRNSSWSCPICNSRNHLPPQYTNLSQENMPLELQSTTIEYITNKPVTVPPIFFFVVDLTSETENLDSLKESIITSLSLLPPNALIGLITYGNVVQLHDLSSETIDRCNVFRGDREYQLEALTEMLTGQKPTGPGGAASHLPNAMNKVTPFSLNRFFLPLEQVEFKLNQLLENLSPDQWSVPAGHRPLRATGSALNIASLLLQGCYKNIPARIILFASGPGTVAPGLIVNSELKDPLRSHHDIDSDHAQHYKKACKFYNQIAQRVAANGHTVDIFAGCYDQIGMSEMKQLTDSTGGVLLLTDAFSTAIFKQSYLRLFAKDEEGYLKMAFNGNMAVKTSKDLKVQGLIGHASAVKKTDANNISESEIGIGATSTWKMASLSPYHSYAIFFEIANTAANSNPMMSAPGSADRPHLAYTQFITTYQHSSGTNRIRVTTVANQLLPFGTPAIAASFDQEAAAVLMARIAVHKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEDDPQPVLLDSISVKPNTILLLDTFFFILIYHGEQIAQWRKAGYQDDPQYADFKALLEEPKLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDNYQDMARGGSTIVLTDDVSLQNFMTHLQQVAVSGQA 69811913848265FB 69811913848265FB sec23p-sec24p-1 3 11 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction hrr25p-sec23p-1 2 9 enzyme enzyme unspecified role unspecified role P29295:p.Lys38Ala K38A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K38A'. Wed May 02 16:35:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys38ala' Tue Jun 30 16:13:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 enzyme target enzyme target substrate substrate unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range pT555 pT555 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain pS742 pS742 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain pT747 pT747 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation sec23p-sar1p-1 8 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 12 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 24-190 Region 24-190 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association sec23p-hrr25p-1 7 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association sec23p-hrr25p-2 6 9 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction sec23p-sar1p-2 4 12 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Region 24-190 Region 24-190 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P15303:p.Ser742Asp S742D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S742D'. Wed May 02 19:00:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser742asp' Tue Jun 30 20:09:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser742Asp' P15303:p.Thr747Glu T747E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E This feature has been corrected as a result of our quality control procedures. The original label was 'T747E'. Wed May 02 17:58:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr747glu' Tue Jun 30 16:21:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr747Glu' P15303:p.[Ser742Asp;Thr747Glu] S742D/T747E mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S742D/T747E'. Wed May 02 20:16:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser742asp,thr747glu' Tue Jun 30 18:48:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser742Asp;Thr747Glu]' ecolx Escherichia coli direct interaction direct interaction hrr25p-sec24p-1 1 11 enzyme target enzyme target substrate substrate unspecified role unspecified role GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 enzyme enzyme unspecified role unspecified role P29295:p.Lys38Ala K38A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K38A'. Wed May 02 15:19:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys38ala' Tue Jun 30 19:47:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation sec23p-trs33p-1 5 10 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P15303:p.[Ser742Asp;Thr747Glu] S742D/T747E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain S D This feature has been corrected as a result of our quality control procedures. The original label was 'S742D/T747E'. Wed May 02 20:16:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser742asp,thr747glu' Tue Jun 30 16:26:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser742Asp;Thr747Glu]' ecolx Escherichia coli physical association physical association