DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. DIP original experiment: DIP-250967X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Joyce MG., Tran P., Zhuravleva MA., Jaw J., Colonna M., Sun PD. DIP original experiment: DIP-250966X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of human natural cytotoxicity receptor NKp30 and identification of its ligand binding site. nctr3_human Natural cytotoxicity triggering receptor 3 NCR3 1C7 LY117 Activating natural killer receptor p30 Natural killer cell p30-related protein protein protein human Homo sapiens Human MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG DIP protein O14931 original sequence version: 110 2855AE4D6902D429 nr3l1_human Natural cytotoxicity triggering receptor 3 ligand 1 NCR3LG1 B7 homolog 6 B7H6 protein protein human Homo sapiens Human MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDAPILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ DIP protein Q68D85 original sequence version: 74 433CE0B0EE0A4470 ncr3-9 2 3 unspecified role unspecified role unspecified role unspecified role Extracellular domain Region 18-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ncr3lg1-ncr3-4 1 4 unspecified role unspecified role bait bait Region 31-144 Region 31-144 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role prey prey Extracellular domain Region 18-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O14931:p.[Ile50Ala;Ser52Ala] I50A/S52A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I50A/S52A'. Wed May 02 16:02:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile50ala,ser52ala' Tue Jun 30 19:19:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile50Ala;Ser52Ala]' O14931:p.[Glu65Ser;Arg67Ser] E65S/R67S mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R S certain certain sequence position certain certain certain sequence position certain E S This feature has been corrected as a result of our quality control procedures. The original label was 'E65S/R67S'. Wed May 02 17:53:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu65ser,arg67ser' Tue Jun 30 16:15:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu65Ser;Arg67Ser]' O14931:p.[Arg109Ser;Glu111Ser;Leu113Ala] R109S/E111S/L113A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain E S certain certain sequence position certain certain certain sequence position certain R S This feature has been corrected as a result of our quality control procedures. The original label was 'R109S/E111S/L113A'. Wed May 02 14:34:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg109ser,glu111ser,leu113ala' Tue Jun 30 17:28:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg109Ser;Glu111Ser;Leu113Ala]' O14931:p.[Arg109Glu;Glu111Arg;Leu113Ala] R109E/E111R/L113A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain R E This feature has been corrected as a result of our quality control procedures. The original label was 'R109E/E111R/L113A'. Wed May 02 15:35:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg109glu,glu111arg,leu113ala' Tue Jun 30 19:26:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg109Glu;Glu111Arg;Leu113Ala]' ecolx Escherichia coli direct interaction direct interaction