DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. Nature 2011 imex curation Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. DIP original experiment: DIP-219115X Nature 2011 IMEx A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. Nature 2011 imex curation Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. DIP original experiment: DIP-219119X Nature 2011 IMEx A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. Nature 2011 imex curation Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. DIP original experiment: DIP-219116X Nature 2011 IMEx A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. Nature 2011 imex curation Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. DIP original experiment: DIP-219118X Nature 2011 IMEx A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. Nature 2011 imex curation Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. DIP original experiment: DIP-219117X Nature 2011 IMEx A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. Nature 2011 imex curation Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Montpetit B., Thomsen ND., Helmke KJ., Seeliger MA., Berger JM., Weis K. DIP original experiment: DIP-219114X Nature 2011 IMEx A conserved mechanism of DEAD-box ATPase activation by nucleoporins and InsP6 in mRNA export. dbp5_yeast ATP-dependent RNA helicase DBP5 YOR046C DBP5 RAT8 DEAD box protein 5 Helicase CA5/6 Ribonucleic acid-trafficking protein 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDTKRDPADLLASLKIDNEKEDTSEVSTKETVKSQPEKTADSIKPAEKLVPKVEEKKTKQEDSNLISSEYEVKVKLADIQADPNSPLYSAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTIGSSIIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHDKNSFNILSAIQKYFGDIEMTRVPTDDWDEVEKIVKKVLKD C50CAFE8C060D46B C50CAFE8C060D46B nu159_yeast Nucleoporin NUP159 NUP158 YIL115C NUP159 RAT7 Nuclear pore protein NUP159 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGTILEPCSGVDTIERLPLVYILNNEGSLQIVGLFHVAAIKSGHYSINLESLEHEKSLSPTSEKIPIAGQEQEEKKKNNESSKALSENPFTSANTSGFTFLKTQPAAANSLQSQSSSTFGAPSFGSSAFKIDLPSVSSTSTGVASSEQDATDPASAKPVFGKPAFGAIAKEPSTSEYAFGKPSFGAPSFGSGKSSVESPASGSAFGKPSFGTPSFGSGNSSVEPPASGSAFGKPSFGTPSFGSGNSSAEPPASGSAFGKPSFGTSAFGTASSNETNSGSIFGKAAFGSSSFAPANNELFGSNFTISKPTVDSPKEVDSTSPFPSSGDQSEDESKSDVDSSSTPFGTKPNTSTKPKTNAFDFGSSSFGSGFSKALESVGSDTTFKFGTQASPFSSQLGNKSPFSSFTKDDTENGSLSKGSTSEINDDNEEHESNGPNVSGNDLTDSTVEQTSSTRLPETPSDEDGEVVEEEAQKSPIGKLTETIKKSANIDMAGLKNPVFGNHVKAKSESPFSAFATNITKPSSTTPAFSFGNSTMNKSNTSTVSPMEEADTKETSEKGPITLKSVENPFLPAKEERTGESSKKDHNDDPKDGYVSGSEISVRTSESAFDTTANEEIPKSQDVNNHEKSETDPKYSQHAVVDHDNKSKEMNETSKNNERSGQPNHGVQGDGIALKKDNEKENFDSNMAIKQFEDHQSSEEDASEKDSRQSSEVKESDDNMSLNSDRDESISESYDKLEDINTDELPHGGEAFKAREVSASADFDVQTSLEDNYAESGIQTDLSESSKENEVQTDAIPVKHNSTQTVKKEAVDNGLQTEPVETCNFSVQTFEGDENYLAEQCKPKQLKEYYTSAKVSNIPFVSQNSTLRLIESTFQTVEAEFTVLMENIRNMDTFFTDQSSIPLVKRTVRSINNLYTWRIPEAEILLNIQNNIKCEQMQITNANIQDLKEKVTDYVRKDIAQITEDVANAKEEYLFLMHFDDASSGYVKDLSTHQFRMQKTLRQKLFDVSAKINHTEELLNILKLFTVKNKRLDDNPLVAKLAKESLARDGLLKEIKLLREQVSRLQLEEKGKKASSFDASSSITKDMKGFKVVEVGLAMNTKKQIGDFFKNLNMAK A33FFA52378F8205 A33FFA52378F8205 gle1_yeast mRNA export factor GLE1 BRR3 RSS1 YDL207W D1049 GLE1 Nuclear pore protein GLE1 RNA export factor GLE1 Nucleoporin GLE1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP C9C6B1513AF95711 C9C6B1513AF95711 dbp5-gle1-2 3 9 unspecified role unspecified role unspecified role unspecified role Region 244-538 Region 244-538 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 303-482 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dbp5-gle1-3 6 9 unspecified role unspecified role unspecified role unspecified role Q12315:p.[Val513Asp;Ala516Asp;Ile520Asp] V513D/A516D/I520D mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I D certain certain sequence position certain certain certain sequence position certain A D certain certain sequence position certain certain certain sequence position certain V D This feature has been corrected as a result of our quality control procedures. The original label was 'V513D/A516D/I520D'. Wed May 02 16:19:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val513asp,ala516asp,ile520asp' Tue Jun 30 19:45:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val513Asp;Ala516Asp;Ile520Asp]' ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 91-482 Region 91-482 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dbp5-gle1-4 4 8 unspecified role unspecified role unspecified role unspecified role Region 2-387 Region 2-387 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 244-538 Region 244-538 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 91-482 Region 91-482 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association dbp5-gle1-5 5 8 unspecified role unspecified role unspecified role unspecified role Region 2-387 Region 2-387 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 9 unspecified role unspecified role unspecified role unspecified role Region 244-538 Region 244-538 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role Region 91-482 Region 91-482 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association dbp5-gle1-6 1 9 unspecified role unspecified role unspecified role unspecified role Region 244-538 Region 244-538 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role C-terminal domain Region 303-482 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction dbp5-gle1-7 2 9 unspecified role unspecified role unspecified role unspecified role Q12315:p.His337Arg H337R mutation mutation certain certain sequence position certain certain certain sequence position certain H R This feature has been corrected as a result of our quality control procedures. The original label was 'H337R'. Wed May 02 16:46:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his337arg' Tue Jun 30 15:38:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His337Arg' ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role P20449:p.[Leu327Val;Lys477Ala;Lys481Ala] K477A/K481A/L327V mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain L V certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K477A/K481A/L327V'. Wed May 02 20:16:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu327val,lys477ala,lys481ala' Tue Jun 30 20:01:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu327Val;Lys477Ala;Lys481Ala]' ecolx Escherichia coli direct interaction direct interaction