DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. DIP original experiment: DIP-249198X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. DIP original experiment: DIP-249197X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. DIP original experiment: DIP-249201X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. DIP original experiment: DIP-249200X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Complex interactions in EML cell stimulation by stem cell factor and IL-3. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ye ZJ., Gulcicek E., Stone K., Lam T., Schulz V., Weissman SM. DIP original experiment: DIP-249199X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Complex interactions in EML cell stimulation by stem cell factor and IL-3. il3ra_mouse Interleukin-3 receptor subunit alpha Il3ra Sut-1 Interleukin-3 receptor class II alpha chain protein protein mouse Mus musculus Mouse MAANLWLILGLLASHSSDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLLYRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA DIP protein P26952 original sequence version: 102 il3rb_mouse Cytokine receptor common subunit beta Csf2rb Aic2b Csf2rb1 Il3rb1 GM-CSF/IL-3/IL-5 receptor common beta subunit protein protein mouse Mus musculus Mouse MDQQMALTWGLCYMALVALCWGHGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGLINMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDSDLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKRLQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPPGASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSLHWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKPISNYDGIWSKWSEEYTWKTDWVMPTLWIVLILVFLILTLLLILRFGCVSVYRTYRKWKEKIPNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGESYAHLEDNNVSPLTIEDPNIIRVPPSGPDTTPAASSESTEQLPNVQVEGPTPNRPRKQLPSFDFNGPYLGPPQSHSLPDLPDQLGSPQVGGSLKPALPGSLEYMCLPPGGQAQLVPLSQVMGQGQAMDVQCGSSLETSGSPSVEPKENPPVELSMEEQEARDNPVTLPISSGGPEGSMMASDYVTPGDPVLTLPTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAAKSPPGHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPSPSLCSETEDLVQDLSVKKFPYQPMPQAPAIQFFKSLKHQDYLSLPPWDNSQSGKVC DIP protein P26955 original sequence version: 113 8E30ECB42C67F89A kit_mouse Mast/stem cell growth factor receptor Kit Proto-oncogene c-Kit Tyrosine-protein kinase Kit Kit Sl protein protein mouse Mus musculus Mouse MRGARGAWDLLCVLLVLLRGQTATSQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTPLLIGFVVAAGAMGIIVMVLTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQAEAALYKNLLHSTEPSCDSSNEYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLDDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPESIFSCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMVSPEHAPAEMYDVMKTCWDADPLKRPTFKQVVQLIEKQISDSTKHIYSNLANCNPNPENPVVVDHSVRVNSVGSSASSTQPLLVHEDA DIP protein P05532 original sequence version: 139 mint This is the receptor for stem cell factor (mast cell growth factor). It has a tyrosine-protein kinase activity. Binding of the ligands leads to the autophosphorylation of KIT and its association with substrates such as phosphatidylinositol 3-kinase (Pi3K) Defects in Kit are the cause of the white-spotting phenotype (W). White-spotting variants induces severe effects on pigmentation, gametogenesis and hematopoiesis. Mice homozygous for W42 die perinatally of macrocytic anemia 03FB4D672248585E csf2rb-kit-1 2 8 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association csf2rb-kit-2 4 8 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association kit-csf2rb-1 1 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association kit-csf2rb-2 3 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association kit-il3ra-1 5 8 unspecified role unspecified role bait bait mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association