DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. DIP original experiment: DIP-253455X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. DIP original experiment: DIP-253452X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. DIP original experiment: DIP-253456X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip autoradiography autoradiography Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. DIP original experiment: DIP-253453X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. Only protein-protein interactions human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. DIP original experiment: DIP-253454X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Teichner A., Eytan E., Sitry-Shevah D., Miniowitz-Shemtov S., Dumin E., Gromis J., Hershko A. DIP original experiment: DIP-253457X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx p31comet Promotes disassembly of the mitotic checkpoint complex in an ATP-dependent process. md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND DIP protein Q13257 original sequence version: 133 DIP protein Q13257 original sequence version: 78 DIP protein Q13257 original sequence version: 105 DIP protein Q13257 original sequence version: 120 DIP protein Q13257 original sequence version: 127 DIP protein Q13257 original sequence version: 116 DIP protein Q13257 original sequence version: 150 DIP protein Q13257 original sequence version: 156 DIP protein Q13257 original sequence version: 134 B8DCBF0043836764 cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR DIP protein Q12834 original sequence version: 132 DIP protein Q12834 original sequence version: 74 DIP protein Q12834 original sequence version: 100 DIP protein Q12834 original sequence version: 118 DIP protein Q12834 original sequence version: 125 DIP protein Q12834 original sequence version: 114 DIP protein Q12834 original sequence version: 147 DIP protein Q12834 original sequence version: 162 FD5C967AF84089E8 bub1b_human Mitotic checkpoint serine/threonine-protein kinase BUB1 beta MAD3/BUB1-related protein kinase Mitotic checkpoint kinase MAD3L SSK1 BUB1B BUBR1 MAD3L Protein SSK1 protein protein human Homo sapiens Human MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARAPIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPMPRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEPSINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVFRKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKLQIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKKNKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVTICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIYSQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQSPWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKLFWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYINCFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMNGVFDTTFQSHLNKALWKVGKLTSPGALLFQ DIP protein O60566 original sequence version: 106 DIP protein O60566 original sequence version: 130 DIP protein O60566-1 original sequence version: 119 DIP protein O60566-1 original sequence version: 154 DIP protein O60566 original sequence version: 154 F7871103A56E6B46 cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF DIP protein P30260 original sequence version: 141 DIP protein P30260 original sequence version: 111 DIP protein P30260 original sequence version: 117 DIP protein P30260 original sequence version: 135 DIP protein P30260 original sequence version: 148 DIP protein P30260 original sequence version: 153 DIP protein P30260 original sequence version: 157 DIP protein P30260 original sequence version: 162 DIP protein P30260 original sequence version: 171 DIP protein P30260 original sequence version: 118 E6C8F59C1EF1DCBA md2bp_human MAD2L1-binding protein Caught by MAD2 protein MAD2L1BP CMT2 KIAA0110 p31(comet) protein protein human Homo sapiens Human MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLEDFFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE DIP protein Q15013 original sequence version: 90 5C49FBE1F456105C bub1b-cdc20-2 2 9 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human 10 unspecified role unspecified role bait bait human Homo sapiens Human association association mad2l1-cdc20-6 3 8 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association bub1b-cdc20-3 5 9 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association cdc20-mad2l1-14 6 8 unspecified role unspecified role bait bait human Homo sapiens Human 7 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association bub1b-mad2l1bp-1 4 9 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association cdc20-mad2l1-15 1 8 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 7 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human physical association physical association