DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Structure (London, England : 1993) 2011 imex curation Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. DIP original experiment: DIP-221412X Structure (London, England : 1993) 2011 IMEx Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Structure (London, England : 1993) 2011 imex curation Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. DIP original experiment: DIP-221416X Structure (London, England : 1993) 2011 IMEx Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Structure (London, England : 1993) 2011 imex curation Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. DIP original experiment: DIP-221414X Structure (London, England : 1993) 2011 IMEx Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Structure (London, England : 1993) 2011 imex curation Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. DIP original experiment: DIP-221415X Structure (London, England : 1993) 2011 IMEx Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Structure (London, England : 1993) 2011 imex curation Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. DIP original experiment: DIP-221417X Structure (London, England : 1993) 2011 IMEx Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Decoy strategies: the structure of TL1A:DcR3 complex. Structure (London, England : 1993) 2011 imex curation Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhan C., Patskovsky Y., Yan Q., Li Z., Ramagopal U., Cheng H., Brenowitz M., Hui X., Nathenson SG., Almo SC. DIP original experiment: DIP-221413X Structure (London, England : 1993) 2011 IMEx Decoy strategies: the structure of TL1A:DcR3 complex. q93038-1 Tumor necrosis factor receptor superfamily member 25 TNFRSF25 APO3 DDR3 DR3 TNFRSF12 WSL WSL1 UNQ455/PRO779 WSL-1 LARD-1A Apo-3 Apoptosis-inducing receptor AIR Apoptosis-mediating receptor DR3 Apoptosis-mediating receptor TRAMP Death receptor 3 Lymphocyte-associated receptor of death Protein WSL Protein WSL-1 protein protein human Homo sapiens Human MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTADEAGMEALTPPPATHLSPLDSAHTLLAPPDSSEKICTVQLVGNSWTPGYPETQEALCPQVTWSWDQLPSRALGPAAAPTLSPESPAGSPAMMLQPGPQLYDVMDAVPARRWKEFVRTLGLREAEIEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRLQRGP DIP protein Q93038-1 original sequence version: 115 o95150-1 Tumor necrosis factor ligand superfamily member 15 TNFSF15 TL1 VEGI TNF ligand-related molecule 1 Vascular endothelial cell growth inhibitor TL1A VEGI-251 protein protein human Homo sapiens Human MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL DIP protein O95150-1 original sequence version: 92 tnfl6_human Tumor necrosis factor ligand superfamily member 6 Fas antigen ligand CD95L Apoptosis antigen ligand FASLG APT1LG1 FASL TNFSF6 CD95 ligand protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL DIP protein P48023 original sequence version: 165 DIP protein P48023-1 original sequence version: 126 DIP protein P48023-1 original sequence version: 130 DIP protein P48023 original sequence version: 152 A8A6EB358246E9BB o43557-1 Tumor necrosis factor ligand superfamily member 14 TNFSF14 HVEML LIGHT UNQ391/PRO726 Herpes virus entry mediator ligand protein protein human Homo sapiens Human MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV DIP protein O43557-1 original sequence version: 109 DIP protein O43557-1 original sequence version: 144 tnf6b_human Tumor necrosis factor receptor superfamily member 6B Decoy receptor for Fas ligand Decoy receptor 3 M68 UNQ186/PRO212 TNFRSF6B DCR3 TR6 protein protein human Homo sapiens Human MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFFAHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLALNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPEGWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH DIP protein O95407 original sequence version: 84 DIP protein O95407 original sequence version: 114 F90AEE33718449AF tnfrsf6b-tnfsf15-1 1 8 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 72-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role unspecified role unspecified role Cysteine-rich domain Region 30-195 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction tnfsf14-tnfrsf6b-1 3 10 unspecified role unspecified role bait bait Ectodomain Region 74-240 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 11 unspecified role unspecified role prey prey Cysteine-rich domain Region 30-195 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O95407:p.[Leu85Ala;Arg89Ala] L85A/R89A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L85A/R89A'. Wed May 02 14:46:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu85ala,arg89ala' Tue Jun 30 18:29:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu85Ala;Arg89Ala]' drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction tnfrsf6b-tnfsf15-2 2 8 unspecified role unspecified role prey prey Ectodomain Region 72-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role bait bait Region 24-300 Region 24-300 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction tnfsf15-tnfrsf6b-1 6 8 unspecified role unspecified role bait bait Ectodomain Region 72-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 unspecified role unspecified role prey prey Cysteine-rich domain Region 30-195 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O95407:p.[Leu85Ala;Arg89Ala] L85A/R89A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L85A/R89A'. Wed May 02 15:02:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu85ala,arg89ala' Tue Jun 30 20:02:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu85Ala;Arg89Ala]' drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction faslg-tnfrsf6b-1 4 9 unspecified role unspecified role bait bait Ectodomain Region 134-281 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 11 unspecified role unspecified role prey prey Cysteine-rich domain Region 30-195 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O95407:p.[Leu85Ala;Arg89Ala] L85A/R89A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L85A/R89A'. Wed May 02 18:11:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu85ala,arg89ala' Tue Jun 30 15:39:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu85Ala;Arg89Ala]' drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction tnfrsf25-tnfsf15-1 5 7 unspecified role unspecified role bait bait Region 25-201 Region 25-201 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 8 unspecified role unspecified role prey prey Ectodomain Region 72-251 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O95150-1:p.[Cys162Ser;Ser187Ala;Glu190Ala;Cys202Ser] C162S/C202S/S187A/E190A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain C S This feature has been corrected as a result of our quality control procedures. The original label was 'C162S/C202S/S187A/E190A'. Wed May 02 20:03:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys162ser,ser187ala,glu190ala,cys202ser' Tue Jun 30 20:25:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys162Ser;Ser187Ala;Glu190Ala;Cys202Ser]' ecolx Escherichia coli direct interaction direct interaction