DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Structure (London, England : 1993) 2011 imex curation Yang Q., Coseno M., Gilmartin GM., Doublié S. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang Q., Coseno M., Gilmartin GM., Doublié S. DIP original experiment: DIP-218781X Structure (London, England : 1993) 2011 IMEx Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Structure (London, England : 1993) 2011 imex curation Yang Q., Coseno M., Gilmartin GM., Doublié S. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang Q., Coseno M., Gilmartin GM., Doublié S. DIP original experiment: DIP-218779X Structure (London, England : 1993) 2011 IMEx Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Structure (London, England : 1993) 2011 imex curation Yang Q., Coseno M., Gilmartin GM., Doublié S. Only protein-protein interactions in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Yang Q., Coseno M., Gilmartin GM., Doublié S. DIP original experiment: DIP-218778X Structure (London, England : 1993) 2011 IMEx Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. Structure (London, England : 1993) 2011 imex curation Yang Q., Coseno M., Gilmartin GM., Doublié S. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang Q., Coseno M., Gilmartin GM., Doublié S. DIP original experiment: DIP-218780X Structure (London, England : 1993) 2011 IMEx Crystal structure of a human cleavage factor CFI(m)25/CFI(m)68/RNA complex provides an insight into poly(A) site recognition and RNA looping. q16630-1 Cleavage and polyadenylation specificity factor subunit 6 CPSF6 CFIM68 Cleavage and polyadenylation specificity factor 68 kDa subunit Pre-mRNA cleavage factor Im 68 kDa subunit Protein HPBRII-4/7 Cleavage factor Im complex 68 kDa subunit protein protein human Homo sapiens Human MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSRRERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDRERDREREYRHR DIP protein Q16630-1 original sequence version: 94 DIP protein Q16630 original sequence version: 123 721A5DA1B456AA79 cpsf5_human Cleavage and polyadenylation specificity factor subunit 5 NUDT21 CFIM25 CPSF25 CPSF5 Cleavage and polyadenylation specificity factor 25 kDa subunit Nucleoside diphosphate-linked moiety X motif 21 Cleavage factor Im complex 25 kDa subunit Nudix hydrolase 21 Pre-mRNA cleavage factor Im 68 kDa subunit protein protein human Homo sapiens Human MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN DIP protein O43809 original sequence version: 95 D204243E57F1CCC5 cpsf6-nudt21-1 3 5 unspecified role unspecified role unspecified role unspecified role RRM domain Region 13-235 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 22-227 Region 22-227 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cpsf6-nudt21-2 4 5 unspecified role unspecified role unspecified role unspecified role RRM domain Region 13-235 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 22-227 Region 22-227 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cpsf6-nudt21-3 2 5 unspecified role unspecified role unspecified role unspecified role RRM domain Region 13-235 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region Δ(116-122) required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ(116-122)'. ecolx Escherichia coli 6 unspecified role unspecified role unspecified role unspecified role Region 22-227 Region 22-227 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain O43809:p.[Tyr158Ala;Tyr160Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:51:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr158ala,tyr160ala' Tue Jun 30 17:03:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr158Ala;Tyr160Ala]' ecolx Escherichia coli direct interaction direct interaction cpsf6-nudt21-4 1 5 unspecified role unspecified role bait bait RRM domain Region 13-235 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey Region 22-227 Region 22-227 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction