DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Nature structural & molecular biology 2011 imex curation Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. DIP original experiment: DIP-218463X Nature structural & molecular biology 2011 IMEx Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Nature structural & molecular biology 2011 imex curation Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. DIP original experiment: DIP-218466X Nature structural & molecular biology 2011 IMEx Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Nature structural & molecular biology 2011 imex curation Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. DIP original experiment: DIP-218462X Nature structural & molecular biology 2011 IMEx Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Nature structural & molecular biology 2011 imex curation Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. Only protein-protein interactions in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. DIP original experiment: DIP-218464X Nature structural & molecular biology 2011 IMEx Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. Nature structural & molecular biology 2011 imex curation Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. Only protein-protein interactions ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ibuki T., Imada K., Minamino T., Kato T., Miyata T., Namba K. DIP original experiment: DIP-218465X Nature structural & molecular biology 2011 IMEx Common architecture of the flagellar type III protein export apparatus and F- and V-type ATPases. flii_salty Flagellum-specific ATP synthase fliI fla AIII flaC STM1972 protein protein salty Salmonella typhimurium MTTRLTRWLTALDNFEAKMALLPAVRRYGRLTRATGLVLEATGLQLPLGATCIIERQDGPETKEVESEVVGFNGQRLFLMPLEEVEGILPGARVYARNGHGDGLQSGKQLPLGPALLGRVLDGGGKPLDGLPAPDTLETGALITPPFNPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGEPPATKGYPPSVFAKLPALVERAGNGIHGGGSITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEAGHYPAIDIEASISRAMTALITEQHYARVRLFKQLLSSFQRNRDLVSVGAYAKGSDPMLDKAITLWPQLEAFLQQGIFERADWEDSLQALDLIFPTV 830867B657592BF1 830867B657592BF1 flij_salty Flagellar FliJ protein flaO flaS STM1973 fliJ protein protein salty Salmonella typhimurium MAQHGALETLKDLAEKEVDDAARLLGEMRRGCQQAEEQLKMLIDYQNEYRSNLNTDMGNGIASNRWINYQQFIQTLEKAIEQHRLQLTQWTQKVDLALKSWREKKQRLQAWQTLQDRQTAAALLAENRMDQKKMDEFAQRAAMRKPE DIP protein P0A1K1 original sequence version: 70 34451B5F4514AF08 flii-1 5 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flii-flij-1 3 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flij-flii-1 2 6 unspecified role unspecified role prey prey Region 111-456 Region 111-456 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region Δ391-400 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This feature has been corrected as a result of our quality control procedures. The original label was 'Δ391-400'. His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range saltm Salmonella typhimurium 7 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range saltm Salmonella typhimurium physical association physical association flii-2 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flii-flij-2 4 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction