DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ladner JE., Pan M., Hurwitz J., Kelman Z. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ladner JE., Pan M., Hurwitz J., Kelman Z. DIP original experiment: DIP-249137X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ladner JE., Pan M., Hurwitz J., Kelman Z. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ladner JE., Pan M., Hurwitz J., Kelman Z. DIP original experiment: DIP-249134X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ladner JE., Pan M., Hurwitz J., Kelman Z. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ladner JE., Pan M., Hurwitz J., Kelman Z. DIP original experiment: DIP-249133X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ladner JE., Pan M., Hurwitz J., Kelman Z. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ladner JE., Pan M., Hurwitz J., Kelman Z. DIP original experiment: DIP-249138X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ladner JE., Pan M., Hurwitz J., Kelman Z. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Ladner JE., Pan M., Hurwitz J., Kelman Z. DIP original experiment: DIP-249136X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Ladner JE., Pan M., Hurwitz J., Kelman Z. Only protein-protein interactions ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Ladner JE., Pan M., Hurwitz J., Kelman Z. DIP original experiment: DIP-249135X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structures of two active proliferating cell nuclear antigens (PCNAs) encoded by Thermococcus kodakaraensis. pcna1_theko DNA polymerase sliding clamp 1 pcn1 Proliferating cell nuclear antigen homolog 1 TK0535 protein protein theko Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) Pyrococcus kodakaraensis (strain KOD1) MPFEVVFDGAKEFADLIATASNLIDEAAFKFTEEGISMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDQFKKILKRGKAKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELELELPELPFTAKVVLLGEVLKEGIKDASLVSDAIKFIAKENEFTMKAEGETNEVEIRLTLEDEGLLDLEVEEETKSAYGIRYLSDMVKGIGKADEVILRFGNEMPLQMEYMIRDEGRLTFLLAPRVEE DIP protein Q5JF32 original sequence version: 47 pcna2_theko DNA polymerase sliding clamp 2 pcn2 Proliferating cell nuclear antigen homolog 2 TK0582 protein protein theko Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) Pyrococcus kodakaraensis (strain KOD1) MTFEIVFDSAREFESLIATLEKFFDEAVFQVNMEGIQMRAIDPSRVVLVDLNLPEMLFSKYSVESEEAIAFDLKRFLKVLKLARSRDTLVLRKGGENFLEVGLLGDENTWFKLPLIDANTPEIEIPSLPWTVKAVVLAGALKRAVKAAKLVSDSIYFMATPEKLTFKAEGNDSEVRTVLTMEDPGLLDLEHKMTKAKSAYGVAYLEDILRSLADADEVIIRFGFDIPLLLKYMVRDAGEVSFLIAPRVEEGRS DIP protein Q5JFD3 original sequence version: 48 pcn2-1 1 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pcn2-2 3 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pcn1-1 4 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pcn1-3 2 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pcn2-3 6 8 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pcn1-4 5 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction